Mouse PIK3R4 Monoclonal Antibody | anti-PIK3R4 antibody

PIK3R4 (Phosphoinositide-3-Kinase, Regulatory Subunit 4, MGC102700, VPS15, p150) (AP)

Cat. Num. AAA6163735

• Gene Names: PIK3R4; p150; VPS15
• Applications: Immunohistochemistry, Western Blot
• Purity: Purified
• Synonyms: PIK3R4; Monoclonal Antibody; PIK3R4 (Phosphoinositide-3-Kinase; Regulatory Subunit 4; MGC102700; VPS15; p150) (AP); Phosphoinositide-3-Kinase; p150; anti-PIK3R4 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1B5
• Specificity: Recognizes PIK3R4.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-PIK3R4 antibody: Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: PIK3R4 (NP_055417, 1259aa-1358aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: AGSDMKIRFWDLAYPERSYVVAGSTSSPSVSYYRKIIEGTEVVQEIQNKQKVGPSDDTPRRGPESLPVGHHDIITDVATFQTTQGFIVTASRDGIVKVWK
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PIK3R4 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PIK3R4 on HeLa cell. [antibody concentration 10 ug/ml])

Western Blot (WB)

(PIK3R4 monoclonal antibody (M02), clone 1B5 Western Blot analysis of PIK3R4 expression in HeLa.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PIK3R4 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 0.6 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PIK3R4 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 0.6 ug/ml])

Testing Data

(Detection limit for recombinant GST tagged PIK3R4 is approximately 0.3ng/ml as a capture antibody.)

Related Product Information for anti-PIK3R4 antibody

Mouse monoclonal antibody raised against a partial recombinant PIK3R4.

Product Categories/Family for anti-PIK3R4 antibody

Antibodies; Protein Kinases

References

1. Insulin activation of vacuolar protein sorting 34 mediates localized phosphatidylinositol 3-phosphate production at lamellipodia and activation of mTOR/S6K1. Hirsch DS, Shen Y, Dokmanovic M, Yu J, Mohan N, Elzarrad MK, Wu WJCell Signal. 2014 Feb 27;26(6):1258-1268. doi: 10.1016/j.cellsig.2014.02.009. 2. Regulation of Mammalian Autophagy by Class II and III PI 3-Kinases through PI3P Synthesis. Devereaux KPLoS One. 2013 Oct 3;8(10):e76405. doi: 10.1371/journal.pone.0076405.

NCBI and Uniprot Product Information

• NCBI GI #: 23943912
• NCBI GeneID: 30849
• NCBI Accession #: NP_055417
• NCBI GenBank Nucleotide #: NM_014602.2
• UniProt Accession #: Q99570; Q2TBF4
• Molecular Weight: Predicted: 149 kDa; ; Observed: 140 kDa
• NCBI Official Full Name: phosphoinositide 3-kinase regulatory subunit 4
• NCBI Official Synonym Full Names: phosphoinositide-3-kinase, regulatory subunit 4
• NCBI Official Symbol: PIK3R4
• NCBI Official Synonym Symbols: p150; VPS15
• NCBI Protein Information: phosphoinositide 3-kinase regulatory subunit 4; PI3-kinase p150 subunit; PI3-kinase regulatory subunit 4; phosphoinositide 3-kinase adaptor protein; phosphatidylinositol 3-kinase-associated p150; phosphoinositide-3-kinase, regulatory subunit 4, p150
• UniProt Protein Name: Phosphoinositide 3-kinase regulatory subunit 4
• Protein Family: Phosphoinositide 3-kinase regulatory
• UniProt Gene Name: PIK3R4
• UniProt Synonym Gene Names: PI3-kinase regulatory subunit 4
• UniProt Entry Name: PI3R4_HUMAN

Uniprot Description

PIK3R4: Regulatory subunit of the PI3K complex. May regulate membrane trafficking late in the endocytic pathway. Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.

Protein type: EC 2.7.11.1; Kinase, protein; Protein kinase, Ser/Thr (non-receptor); Kinase, lipid; Protein kinase, Other; Other group; VPS15 family

Chromosomal Location of Human Ortholog: 3q22.1

Cellular Component: membrane; late endosome; nuclear pore; axoneme; cytosol

Molecular Function: protein serine/threonine kinase activity; protein binding; ATP binding; protein kinase activity

Biological Process: macroautophagy; phospholipid metabolic process; late endosome to vacuole transport; toll-like receptor signaling pathway; phosphatidylinositol biosynthetic process; insulin receptor signaling pathway; innate immune response; protein targeting to vacuole; toll-like receptor 9 signaling pathway; peroxisome degradation; protein amino acid phosphorylation