Mouse anti-Human PIK3CG Monoclonal Antibody | anti-PIK3CG antibody

PIK3CG (Phosphatidylinositol-4,5-bisphosphate 3-kinase Catalytic Subunit gamma Isoform, PtdIns-3-kinase Subunit gamma, PI3K-gamma, Phosphatidylinositol-4,5-bisphosphate 3-kinase 110kD Catalytic Subunit gamma, PtdIns-3-kinase Subunit p110-gamma, p120-PI3K)

Cat. Num. AAA6154169

• Gene Names: PIK3CG; PI3K; PIK3; PI3CG; PI3Kgamma; p110gamma; p120-PI3K
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PIK3CG; Monoclonal Antibody; PIK3CG (Phosphatidylinositol-4; 5-bisphosphate 3-kinase Catalytic Subunit gamma Isoform; PtdIns-3-kinase Subunit gamma; PI3K-gamma; Phosphatidylinositol-4; 5-bisphosphate 3-kinase 110kD Catalytic Subunit gamma; PtdIns-3-kinase Subunit p110-gamma; p120-PI3K); anti-PIK3CG antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2G3
• Specificity: Recognizes human PIK3CG.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-PIK3CG antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-100 from human PIK3CG (AAH35683) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MELENYKQPVVLREDNCRRRRRMKPRSAAASLSSMELIPIEFVLPTSQRKCKSPETALLHVAGHGNVEQMKAQVWLRALETSVAADFYHRLGPHHFLLLY
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PIK3CG on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged PIK3CG is ~10ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis of protein-protein interactions between KIT and PIK3CG HeLa cells were stained with KIT rabbit purified polyclonal 1:1200 and PIK3CG mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Related Product Information for anti-PIK3CG antibody

PIK3CG belongs to the pi3/pi4-kinase family of proteins. It is an enzyme that phosphorylates phosphoinositides on the 3-hydroxyl group of the inositol ring. It is an important modulator of extracellular signals, including those elicited by E-cadherin-mediated cell-cell adhesion, which play an important role in maintenance of the structural and functional integrity of epithelia. In addition to its role in promoting assembly of adherens junctions, the protein is thought to play a pivotal role in the regulation of cytotoxicity in NK cells.

Product Categories/Family for anti-PIK3CG antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 23274229
• NCBI GeneID: 5294
• Molecular Weight: 126,454 Da
• NCBI Official Full Name: Homo sapiens phosphoinositide-3-kinase, catalytic, gamma polypeptide, mRNA
• NCBI Official Synonym Full Names: phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma
• NCBI Official Symbol: PIK3CG
• NCBI Official Synonym Symbols: PI3K; PIK3; PI3CG; PI3Kgamma; p110gamma; p120-PI3K
• NCBI Protein Information: phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
• Protein Family: Phosphatidylinositol 4,5-bisphosphate 3-kinase

NCBI Description

Phosphoinositide 3-kinases (PI3Ks) phosphorylate inositol lipids and are involved in the immune response. The protein encoded by this gene is a class I catalytic subunit of PI3K. Like other class I catalytic subunits (p110-alpha p110-beta, and p110-delta), the encoded protein binds a p85 regulatory subunit to form PI3K. This gene is located in a commonly deleted segment of chromosome 7 previously identified in myeloid leukemias. Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jun 2015]