Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse anti-Human PIK3C2G Monoclonal Antibody | anti-PIK3C2G antibody

PIK3C2G (Phosphatidylinositol-4-phosphate 3-kinase C2 Domain-containing Subunit gamma, Phosphoinositide 3-kinase-C2-gamma, PI3K-C2gamma, PI3K-C2-gamma, PIK3C2G, PtdIns-3-kinase C2 Subunit gamma, MGC163149) (AP)

Gene Names
PIK3C2G; PI3K-C2GAMMA; PI3K-C2-gamma
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PIK3C2G; Monoclonal Antibody; PIK3C2G (Phosphatidylinositol-4-phosphate 3-kinase C2 Domain-containing Subunit gamma; Phosphoinositide 3-kinase-C2-gamma; PI3K-C2gamma; PI3K-C2-gamma; PtdIns-3-kinase C2 Subunit gamma; MGC163149) (AP); anti-PIK3C2G antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3D8
Specificity
Recognizes human PIK3C2G.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
1445
Applicable Applications for anti-PIK3C2G antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa2-101 from human PIK3C2G (NP_004561) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AYSWQTDPNPNESHEKQYEHQEFLFVNQPHSSSQVSLGFDQIVDEISGKIPHYESEIDENTFFVPTAPKWDSTGHSLNEAHQISLNEFTSKSRELSWHQ
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)
Related Product Information for anti-PIK3C2G antibody
PI3KC2G belongs to the phosphoinositide 3-kinase (PI3K) family. PI3-kinases play roles in signaling pathways involved in cell proliferation, oncogenic transformation, cell survival, cell migration, and intracellular protein trafficking. This protein contains a lipid kinase catalytic domain as well as a C-terminal C2 domain, a characteristic of class II PI3-kinases. C2 domains act as calcium-dependent phospholipid binding motifs that mediate translocation of proteins to membranes, and may also mediate protein-protein interactions. The biological function of this gene has not yet been determined.
Product Categories/Family for anti-PIK3C2G antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit gamma isoform 3
NCBI Official Synonym Full Names
phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 gamma
NCBI Official Symbol
PIK3C2G
NCBI Official Synonym Symbols
PI3K-C2GAMMA; PI3K-C2-gamma
NCBI Protein Information
phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit gamma
UniProt Protein Name
Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit gamma
UniProt Gene Name
PIK3C2G
UniProt Synonym Gene Names
PI3K-C2-gamma; PtdIns-3-kinase C2 subunit gamma

NCBI Description

The protein encoded by this gene belongs to the phosphoinositide 3-kinase (PI3K) family. PI3-kinases play roles in signaling pathways involved in cell proliferation, oncogenic transformation, cell survival, cell migration, and intracellular protein trafficking. This protein contains a lipid kinase catalytic domain as well as a C-terminal C2 domain, a characteristic of class II PI3-kinases. C2 domains act as calcium-dependent phospholipid binding motifs that mediate translocation of proteins to membranes, and may also mediate protein-protein interactions. This gene may play a role in several diseases, including type II diabetes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]

Uniprot Description

PIK3C2G: Generates phosphatidylinositol 3-phosphate (PtdIns3P) and phosphatidylinositol 3,4-bisphosphate (PtdIns(3,4)P2) that act as second messengers. May play a role in SDF1A-stimulated chemotaxis. Belongs to the PI3/PI4-kinase family.

Protein type: Carbohydrate Metabolism - inositol phosphate; EC 2.7.1.154; Kinase, lipid; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 12p12.3

Cellular Component: cytoplasm; cytosol; phosphoinositide 3-kinase complex; plasma membrane

Molecular Function: 1-phosphatidylinositol-3-kinase activity; ATP binding; phosphatidylinositol binding; phosphatidylinositol phosphate kinase activity; phosphatidylinositol-4-phosphate 3-kinase activity

Biological Process: cell migration; chemotaxis; phosphatidylinositol biosynthetic process; phosphatidylinositol phosphorylation; phosphoinositide 3-kinase cascade

Research Articles on PIK3C2G

Similar Products

Product Notes

The PIK3C2G pik3c2g (Catalog #AAA6132954) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PIK3C2G (Phosphatidylinositol-4-phosphate 3-kinase C2 Domain-containing Subunit gamma, Phosphoinositide 3-kinase-C2-gamma, PI3K-C2gamma, PI3K-C2-gamma, PIK3C2G, PtdIns-3-kinase C2 Subunit gamma, MGC163149) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PIK3C2G can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PIK3C2G pik3c2g for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PIK3C2G, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.