Testing Data
(Detection limit for recombinant GST tagged PIGT is 1ng/ml as a capture antibody.)
Mouse anti-Human PIGT Monoclonal Antibody | anti-PIGT antibody
PIGT (GPI Transamidase Component PIG-T, Phosphatidylinositol-glycan Biosynthesis Class T Protein, CGI-06, PSEC0163, UNQ716/PRO1379, FLJ41596, MGC8909) (Biotin)
Gene Names
PIGT; NDAP; PNH2; CGI-06; MCAHS3
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PIGT; Monoclonal Antibody; PIGT (GPI Transamidase Component PIG-T; Phosphatidylinositol-glycan Biosynthesis Class T Protein; CGI-06; PSEC0163; UNQ716/PRO1379; FLJ41596; MGC8909) (Biotin); anti-PIGT antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2A2
Specificity
Recognizes human PIGT.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
578
Applicable Applications for anti-PIGT antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa24-124 from human PIGT (NP_057021) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EPPRDSLREELVITPLPSGDVAATFQFRTRWDSELQREGVSHYRLFPKALGQLISKYSLRELHLSFTQGFWRTRYWGPPFLQAPSGAELWVWFQDTVTDV*
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged PIGT is 1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged PIGT is 1ng/ml as a capture antibody.)
Related Product Information for anti-PIGT antibody
This gene encodes a protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. This protein is an essential component of the multisubunit enzyme, GPI transamidase. GPI transamidase mediates GPI anchoring in the endoplasmic reticulum, by catalyzing the transfer of fully assembled GPI units to proteins. Several transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-PIGT antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
GPI transamidase component PIG-T isoform 1
NCBI Official Synonym Full Names
phosphatidylinositol glycan anchor biosynthesis class T
NCBI Official Symbol
PIGT
NCBI Official Synonym Symbols
NDAP; PNH2; CGI-06; MCAHS3
NCBI Protein Information
GPI transamidase component PIG-T
UniProt Protein Name
GPI transamidase component PIG-T
Protein Family
UniProt Gene Name
PIGT
UniProt Synonym Gene Names
CGI-06; PSEC0163; UNQ716/PRO1379
UniProt Entry Name
PIGT_HUMAN
NCBI Description
This gene encodes a protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. This protein is an essential component of the multisubunit enzyme, GPI transamidase. GPI transamidase mediates GPI anchoring in the endoplasmic reticulum, by catalyzing the transfer of fully assembled GPI units to proteins. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, May 2012]
Research Articles on PIGT
Similar Products
Product Notes
The PIGT pigt (Catalog #AAA6143555) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PIGT (GPI Transamidase Component PIG-T, Phosphatidylinositol-glycan Biosynthesis Class T Protein, CGI-06, PSEC0163, UNQ716/PRO1379, FLJ41596, MGC8909) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PIGT can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PIGT pigt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PIGT, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
