Western Blot (WB)
(Western Blot: Sample: Rat Cerebrum lysate; Primary Ab: 2ug/ml Rabbit Anti-Rat GAD1 Antibody Second Ab: 0.2ug/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody )
Rabbit anti-Rat Glutamate Decarboxylase 1, Brain (GAD1) Polyclonal Antibody | anti-GAD1 antibody
Polyclonal Antibody to Glutamate Decarboxylase 1, Brain (GAD1)
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-MASSTPSPAT SSNAGADPNT TNLRPTTYDT WCGVAHGCTR KLGLKICGFL QRTNSLEEKS RLVSAFRERQ ASKNLLSCEN SDPGARFRRT ETDFSNL
Immunocytochemistry in formalin fixed cells: 1:100-500
Immunohistochemistry in formalin fixed frozen section: 1:100-500
Immunohistochemistry in paraffin section: 1:50-200
Enzyme-linked Immunosorbent Assay: 1:100-200
Western Blot (WB)
(Western Blot: Sample: Rat Cerebrum lysate; Primary Ab: 2ug/ml Rabbit Anti-Rat GAD1 Antibody Second Ab: 0.2ug/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody )
Western Blot (WB)
(Western Blot: Sample: Rat Cerebrum lysate; Primary Ab: 2ug/ml Rabbit Anti-Rat GAD1 Antibody Second Ab: 0.2ug/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody )
Western Blot (WB)
(Western Blot: Sample: Recombinant protein.)
Western Blot (WB)
(Western Blot: Sample: Recombinant protein.)
Immunohistochemistry (IHC)
(DAB staining on fromalin fixed paraffin-embedded brain tissue))
Immunohistochemistry (IHC)
(DAB staining on fromalin fixed paraffin-embedded brain tissue))
NCBI and Uniprot Product Information
NCBI Description
plays a role in the biosynthesis of gamma-aminobutyric acid [RGD, Feb 2006]
Uniprot Description
GAD67: Catalyzes the production of GABA. Homodimer. Isoform 3 is expressed in pancreatic islets, testis, adrenal cortex, and perhaps other endocrine tissues, but not in brain. Belongs to the group II decarboxylase family. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: Amino Acid Metabolism - alanine, aspartate and glutamate; Carbohydrate Metabolism - butanoate; EC 4.1.1.15; Lyase; Mitochondrial; Other Amino Acids Metabolism - beta-alanine; Other Amino Acids Metabolism - taurine and hypotaurine
Chromosomal Location of Human Ortholog: 3q22
Cellular Component: axon; axon terminus; cell cortex; cytoplasm; intracellular; mitochondrion; presynaptic active zone; synapse
Molecular Function: carboxy-lyase activity; glutamate binding; glutamate decarboxylase activity; protein heterodimerization activity; protein N-terminus binding; pyridoxal phosphate binding
Biological Process: carboxylic acid metabolic process; gamma-aminobutyric acid biosynthetic process; neurotransmitter biosynthetic process; response to drug; social behavior
Research Articles on GAD1
Similar Products
Product Notes
The GAD1 gad1 (Catalog #AAA2005360) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Polyclonal Antibody to Glutamate Decarboxylase 1, Brain (GAD1) reacts with Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Glutamate Decarboxylase 1, Brain (GAD1) can be used in a range of immunoassay formats including, but not limited to, Immunocytochemistry (ICC), Immunohistochemistry (IHC) - Formalin/Paraffin, ELISA (EIA), Western Blot (WB). Western blotting: 1:100-400 Immunocytochemistry in formalin fixed cells: 1:100-500 Immunohistochemistry in formalin fixed frozen section: 1:100-500 Immunohistochemistry in paraffin section: 1:50-200 Enzyme-linked Immunosorbent Assay: 1:100-200. Researchers should empirically determine the suitability of the GAD1 gad1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Antigen: The target protein is fused with two N-terminal Tags, His-tag and its sequence is listed below. MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGS EF-MASSTPS PAT SSNAGADPNT TNLRPTTYDT WCGVAHGCTR KLGLKICGFL QRTNSLEEKS RLVSAFRERQ ASKNLLSCEN SDPGARFRRT ETDFSNL. It is sometimes possible for the material contained within the vial of "Glutamate Decarboxylase 1, Brain (GAD1), Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
