Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (33.7kD).)

Mouse anti-Human, Mouse PIGS Monoclonal Antibody | anti-PIGS antibody

PIGS (Phosphatidylinositol Glycan Class S1, DKFZp686K202162, FLJ452262, GPI Transamidase Subunit) (HRP)

Reactivity
Human, Mouse
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PIGS; Monoclonal Antibody; PIGS (Phosphatidylinositol Glycan Class S1; DKFZp686K202162; FLJ452262; GPI Transamidase Subunit) (HRP); anti-PIGS antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3F3
Specificity
Recognizes human PIGS. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-PIGS antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa450-519 from human PIGS (NP_149975) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GKISNIVIKDDVASEVYKAVAAVQKSAEELASGHLASAFVASQEAVTSSELAFFDPSLLHLLYFPDDQK
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (33.7kD).)

Western Blot (WB) (Western Blot detection against Immunogen (33.7kD).)

Western Blot (WB)

(PIGS monoclonal antibody. Western Blot analysis of PIGS expression in NIH/3T3.)

Western Blot (WB) (PIGS monoclonal antibody. Western Blot analysis of PIGS expression in NIH/3T3.)

Testing Data

(Detection limit for recombinant GST tagged PIGS is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PIGS is 1ng/ml as a capture antibody.)
Related Product Information for anti-PIGS antibody
This gene encodes a protein that is involved in GPI-anchor biosynthesis. The glycosylphosphatidylinositol (GPI) anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. This gene encodes an essential component of the multisubunit enzyme, GPI transamidase. GPI transamidase mediates GPI anchoring in the endoplasmic reticulum, by catalyzing the transfer of fully assembled GPI units to proteins. [provided by RefSeq]
Product Categories/Family for anti-PIGS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61,005 Da
NCBI Official Full Name
GPI transamidase component PIG-S
NCBI Official Synonym Full Names
phosphatidylinositol glycan anchor biosynthesis class S
NCBI Official Symbol
PIGS
NCBI Protein Information
GPI transamidase component PIG-S
UniProt Protein Name
GPI transamidase component PIG-S
UniProt Gene Name
PIGS

NCBI Description

This gene encodes a protein that is involved in GPI-anchor biosynthesis. The glycosylphosphatidylinositol (GPI) anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. This gene encodes an essential component of the multisubunit enzyme, GPI transamidase. GPI transamidase mediates GPI anchoring in the endoplasmic reticulum, by catalyzing the transfer of fully assembled GPI units to proteins. [provided by RefSeq, Jul 2008]

Uniprot Description

PIGS: Component of the GPI transamidase complex. Essential for transfer of GPI to proteins, particularly for formation of carbonyl intermediates. Belongs to the PIGS family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Glycan Metabolism - glycosylphosphatidylinositol (GPI)-anchor biosynthesis; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 17q11.2

Cellular Component: endoplasmic reticulum membrane; GPI-anchor transamidase complex; membrane

Molecular Function: GPI-anchor transamidase activity; protein binding

Biological Process: attachment of GPI anchor to protein

Similar Products

Product Notes

The PIGS pigs (Catalog #AAA6154160) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PIGS (Phosphatidylinositol Glycan Class S1, DKFZp686K202162, FLJ452262, GPI Transamidase Subunit) (HRP) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's PIGS can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PIGS pigs for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PIGS, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.