Mouse anti-Human PIGP Monoclonal Antibody | anti-PIGP antibody

PIGP (Phosphatidylinositol N-acetylglucosaminyltransferase Subunit P, Down Syndrome Critical Region Protein 5, Down Syndrome Critical Region Protein C, Phosphatidylinositol-glycan Biosynthesis Class P Protein, PIG-P, DCRC, DSCR5, DSCRC, NPD010) (MaxLight

Cat. Num. AAA6191810

• Gene Names: PIGP; DCRC; DSRC; DSCR5; PIG-P; DCRC-S; EIEE55
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PIGP; Monoclonal Antibody; PIGP (Phosphatidylinositol N-acetylglucosaminyltransferase Subunit P; Down Syndrome Critical Region Protein 5; Down Syndrome Critical Region Protein C; Phosphatidylinositol-glycan Biosynthesis Class P Protein; PIG-P; DCRC; DSCR5; DSCRC; NPD010) (MaxLight; anti-PIGP antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2E7
• Specificity: Recognizes human PIGP.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
• Sequence Length: 134

• Applicable Applications for anti-PIGP antibody: FLISA, Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa77-135 from human PIGP (NP_710149) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: NMMSTSPLDSIHTITDNYAKNQQQKKYQEEAIPALRDISISEVNQMFFLAAKELYTKN
• Conjugate: MaxLight405
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-PIGP antibody

Part of the complex catalyzing the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, the first step of GPI biosynthesis.

Product Categories/Family for anti-PIGP antibody

Antibodies; Enzymes; Phospholipase

NCBI and Uniprot Product Information

• NCBI GI #: 24497599
• NCBI GeneID: 51227
• NCBI Accession #: NP_710149
• NCBI GenBank Nucleotide #: NM_153682
• UniProt Accession #: P57054
• NCBI Official Full Name: phosphatidylinositol N-acetylglucosaminyltransferase subunit P isoform 2
• NCBI Official Synonym Full Names: phosphatidylinositol glycan anchor biosynthesis class P
• NCBI Official Symbol: PIGP
• NCBI Official Synonym Symbols: DCRC; DSRC; DSCR5; PIG-P; DCRC-S; EIEE55
• NCBI Protein Information: phosphatidylinositol N-acetylglucosaminyltransferase subunit P
• UniProt Protein Name: Phosphatidylinositol N-acetylglucosaminyltransferase subunit P
• UniProt Gene Name: PIGP
• UniProt Synonym Gene Names: DCRC; DSCR5; DSCRC; PIG-P
• UniProt Entry Name: PIGP_HUMAN

NCBI Description

This gene encodes an enzyme involved in the first step of glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells that serves to anchor proteins to the cell surface. The encoded protein is a component of the GPI-N-acetylglucosaminyltransferase complex that catalyzes the transfer of N-acetylglucosamine (GlcNAc) from UDP-GlcNAc to phosphatidylinositol (PI). This gene is located in the Down Syndrome critical region on chromosome 21 and is a candidate for the pathogenesis of Down syndrome. This gene has multiple pseudogenes and is a member of the phosphatidylinositol glycan anchor biosynthesis gene family. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Feb 2016]