Mouse anti-Human PIGL Monoclonal Antibody | anti-PIGL antibody

PIGL (N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase, Phosphatidylinositol-glycan Biosynthesis Class L Protein, PIG-L) (FITC)

Cat. Num. AAA6148853

• Gene Names: PIGL; CHIME
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PIGL; Monoclonal Antibody; PIGL (N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase; Phosphatidylinositol-glycan Biosynthesis Class L Protein; PIG-L) (FITC); anti-PIGL antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 2B6
• Specificity: Recognizes human PIGL.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-PIGL antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa152-253 from PIGL (NP_004269) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GHSNHIALYAAVRALHSEGKLPKGCSVLTLQSVNVLRKYISLLDLPLSLLHTQDVLFVLNSKEVAQAKKAMSCHRSQLLWFRRLYIIFSRYMRINSLSFL
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged PIGL is ~1ng/ml as a capture antibody)

Related Product Information for anti-PIGL antibody

This gene encodes an enzyme that catalyzes the second step of glycosylphosphatidylinositol (GPI) biosynthesis, which is the de-N-acetylation of N-acetylglucosaminylphosphatidylinositol (GlcNAc-PI). Study of a similar rat enzyme suggests that this protein localizes to the endoplasmic reticulum. [provided by RefSeq].

Product Categories/Family for anti-PIGL antibody

Antibodies; Enzymes; Phospholipase

NCBI and Uniprot Product Information

• NCBI GI #: 4758922
• NCBI GeneID: 9487
• NCBI Accession #: NP_004269
• NCBI GenBank Nucleotide #: NM_004278
• UniProt Accession #: Q9Y2B2
• Molecular Weight: 28kDa
• NCBI Official Full Name: N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase
• NCBI Official Synonym Full Names: phosphatidylinositol glycan anchor biosynthesis class L
• NCBI Official Symbol: PIGL
• NCBI Official Synonym Symbols: CHIME
• NCBI Protein Information: N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase
• UniProt Protein Name: N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase
• UniProt Gene Name: PIGL
• UniProt Synonym Gene Names: PIG-L
• UniProt Entry Name: PIGL_HUMAN

NCBI Description

This gene encodes an enzyme that catalyzes the second step of glycosylphosphatidylinositol (GPI) biosynthesis, which is the de-N-acetylation of N-acetylglucosaminylphosphatidylinositol (GlcNAc-PI). Study of a similar rat enzyme suggests that this protein localizes to the endoplasmic reticulum. [provided by RefSeq, Jul 2008]

Uniprot Description

PIGL: Involved in the second step of GPI biosynthesis. De-N- acetylation of N-acetylglucosaminyl-phosphatidylinositol. Defects in PIGL are the cause of coloboma, congenital heart disease, ichthyosiform dermatosis, mental retardation and ear anomalies syndrome (CHIME). An extremely rare autosomal recessive multisystem disorder clinically characterized by colobomas, congenital heart defects, migratory ichthyosiform dermatosis, mental retardation, and ear anomalies including conductive hearing loss. Other clinical features include distinctive facial features, abnormal growth, genitourinary abnormalities, seizures, and feeding difficulties. Belongs to the PIGL family.

Protein type: Glycan Metabolism - glycosylphosphatidylinositol (GPI)-anchor biosynthesis; EC 3.5.1.89; Membrane protein, integral; Deacetylase

Chromosomal Location of Human Ortholog: 17p11.2

Cellular Component: endoplasmic reticulum membrane; integral to membrane

Molecular Function: N-acetylglucosaminylphosphatidylinositol deacetylase activity

Biological Process: cellular protein metabolic process; preassembly of GPI anchor in ER membrane; GPI anchor biosynthetic process; C-terminal protein lipidation; post-translational protein modification

Disease: Coloboma, Congenital Heart Disease, Ichthyosiform Dermatosis, Mental Retardation, And Ear Anomalies Syndrome