Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged PIGL is ~1ng/ml as a capture antibody)

Mouse anti-Human PIGL Monoclonal Antibody | anti-PIGL antibody

PIGL (N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase, Phosphatidylinositol-glycan Biosynthesis Class L Protein, PIG-L) (AP)

Gene Names
PIGL; CHIME
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PIGL; Monoclonal Antibody; PIGL (N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase; Phosphatidylinositol-glycan Biosynthesis Class L Protein; PIG-L) (AP); anti-PIGL antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2B6
Specificity
Recognizes human PIGL.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-PIGL antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa152-253 from PIGL (NP_004269) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GHSNHIALYAAVRALHSEGKLPKGCSVLTLQSVNVLRKYISLLDLPLSLLHTQDVLFVLNSKEVAQAKKAMSCHRSQLLWFRRLYIIFSRYMRINSLSFL
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged PIGL is ~1ng/ml as a capture antibody)

Testing Data (Detection limit for recombinant GST tagged PIGL is ~1ng/ml as a capture antibody)
Related Product Information for anti-PIGL antibody
This gene encodes an enzyme that catalyzes the second step of glycosylphosphatidylinositol (GPI) biosynthesis, which is the de-N-acetylation of N-acetylglucosaminylphosphatidylinositol (GlcNAc-PI). Study of a similar rat enzyme suggests that this protein localizes to the endoplasmic reticulum. [provided by RefSeq].
Product Categories/Family for anti-PIGL antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase
NCBI Official Synonym Full Names
phosphatidylinositol glycan anchor biosynthesis class L
NCBI Official Symbol
PIGL
NCBI Official Synonym Symbols
CHIME
NCBI Protein Information
N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase
UniProt Protein Name
N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase
UniProt Gene Name
PIGL
UniProt Synonym Gene Names
PIG-L
UniProt Entry Name
PIGL_HUMAN

NCBI Description

This gene encodes an enzyme that catalyzes the second step of glycosylphosphatidylinositol (GPI) biosynthesis, which is the de-N-acetylation of N-acetylglucosaminylphosphatidylinositol (GlcNAc-PI). Study of a similar rat enzyme suggests that this protein localizes to the endoplasmic reticulum. [provided by RefSeq, Jul 2008]

Uniprot Description

PIGL: Involved in the second step of GPI biosynthesis. De-N- acetylation of N-acetylglucosaminyl-phosphatidylinositol. Defects in PIGL are the cause of coloboma, congenital heart disease, ichthyosiform dermatosis, mental retardation and ear anomalies syndrome (CHIME). An extremely rare autosomal recessive multisystem disorder clinically characterized by colobomas, congenital heart defects, migratory ichthyosiform dermatosis, mental retardation, and ear anomalies including conductive hearing loss. Other clinical features include distinctive facial features, abnormal growth, genitourinary abnormalities, seizures, and feeding difficulties. Belongs to the PIGL family.

Protein type: Glycan Metabolism - glycosylphosphatidylinositol (GPI)-anchor biosynthesis; EC 3.5.1.89; Membrane protein, integral; Deacetylase

Chromosomal Location of Human Ortholog: 17p11.2

Cellular Component: endoplasmic reticulum membrane; integral to membrane

Molecular Function: N-acetylglucosaminylphosphatidylinositol deacetylase activity

Biological Process: cellular protein metabolic process; preassembly of GPI anchor in ER membrane; GPI anchor biosynthetic process; C-terminal protein lipidation; post-translational protein modification

Disease: Coloboma, Congenital Heart Disease, Ichthyosiform Dermatosis, Mental Retardation, And Ear Anomalies Syndrome

Research Articles on PIGL

Similar Products

Product Notes

The PIGL pigl (Catalog #AAA6132944) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PIGL (N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase, Phosphatidylinositol-glycan Biosynthesis Class L Protein, PIG-L) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PIGL can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PIGL pigl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PIGL, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.