Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human PIGH Monoclonal Antibody | anti-PIGH antibody

PIGH (Phosphatidylinositol N-acetylglucosaminyltransferase Subunit H, Phosphatidylinositol-glycan Biosynthesis Class H Protein) (MaxLight 750)

Gene Names
PIGH; GPI-H
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PIGH; Monoclonal Antibody; PIGH (Phosphatidylinositol N-acetylglucosaminyltransferase Subunit H; Phosphatidylinositol-glycan Biosynthesis Class H Protein) (MaxLight 750); anti-PIGH antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F8
Specificity
Recognizes human PIGH.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Sequence Length
188
Applicable Applications for anti-PIGH antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa89-189 from human PIGH (NP_004560) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TLLIIDSLGIQMTSSYASGKESTTFIEMGKVKDIVINEAIYMQKVIYYLCILLKDPVEPHGISQVVPVFQSAKPRLDCLIEVYRSCQEILAHQKATSTSP
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-PIGH antibody
This gene encodes an endoplasmic reticulum associated protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI anchor is a glycolipid found on many blood cells and which serves to anchor proteins to the cell surface. The protein encoded by this gene is a subunit of the GPI N-acetylglucosaminyl (GlcNAc) transferase that transfers GlcNAc to phosphatidylinositol (PI) on the cytoplasmic side of the endoplasmic reticulum.
Product Categories/Family for anti-PIGH antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
phosphatidylinositol N-acetylglucosaminyltransferase subunit H isoform 1
NCBI Official Synonym Full Names
phosphatidylinositol glycan anchor biosynthesis class H
NCBI Official Symbol
PIGH
NCBI Official Synonym Symbols
GPI-H
NCBI Protein Information
phosphatidylinositol N-acetylglucosaminyltransferase subunit H
UniProt Protein Name
Phosphatidylinositol N-acetylglucosaminyltransferase subunit H
UniProt Gene Name
PIGH
UniProt Synonym Gene Names
PIG-H
UniProt Entry Name
PIGH_HUMAN

NCBI Description

This gene encodes an endoplasmic reticulum associated protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI anchor is a glycolipid found on many blood cells and which serves to anchor proteins to the cell surface. The protein encoded by this gene is a subunit of the GPI N-acetylglucosaminyl (GlcNAc) transferase that transfers GlcNAc to phosphatidylinositol (PI) on the cytoplasmic side of the endoplasmic reticulum. [provided by RefSeq, Jul 2008]

Uniprot Description

PIGH: Part of the complex catalyzing the transfer of N- acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, the first step of GPI biosynthesis. Belongs to the PIGH family.

Protein type: Glycan Metabolism - glycosylphosphatidylinositol (GPI)-anchor biosynthesis; EC 2.4.1.198; Endoplasmic reticulum; Transferase

Chromosomal Location of Human Ortholog: 14q24.1

Cellular Component: endoplasmic reticulum membrane; glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex; endoplasmic reticulum

Molecular Function: phosphatidylinositol N-acetylglucosaminyltransferase activity; catalytic activity

Biological Process: cellular protein metabolic process; preassembly of GPI anchor in ER membrane; GPI anchor biosynthetic process; protein modification process; C-terminal protein lipidation; post-translational protein modification

Research Articles on PIGH

Similar Products

Product Notes

The PIGH pigh (Catalog #AAA6234507) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PIGH (Phosphatidylinositol N-acetylglucosaminyltransferase Subunit H, Phosphatidylinositol-glycan Biosynthesis Class H Protein) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PIGH can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PIGH pigh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PIGH, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.