Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Mouse anti-Human PIAS3 Monoclonal Antibody | anti-PIAS3 antibody

PIAS3 (E3 SUMO-protein Ligase PIAS3, Protein Inhibitor of Activated STAT Protein 3, FLJ14651, ZMIZ5) (PE)

Gene Names
PIAS3; ZMIZ5
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PIAS3; Monoclonal Antibody; PIAS3 (E3 SUMO-protein Ligase PIAS3; Protein Inhibitor of Activated STAT Protein 3; FLJ14651; ZMIZ5) (PE); anti-PIAS3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4F12
Specificity
Recognizes human PIAS3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-PIAS3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa453-550 from PIAS3 (NP_006090) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PPTKKHCSVTSAAIPALPGSKGVLTSGHQPSSVLRSPAMGTLGGDFLSSLPLHEYPPAFPLGADIQGLDLFSFLQTESQHYGPSVITSLDEQDALGHF
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB)

(Western Blot analysis of PIAS3 expression in transfected 293T cell line by PIAS3 monoclonal antibody. Lane 1: PIAS3 transfected lysate (67kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PIAS3 expression in transfected 293T cell line by PIAS3 monoclonal antibody. Lane 1: PIAS3 transfected lysate (67kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(Western blot analysis of PIAS3 over-expressed 293 cell line, cotransfected with PIAS3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PIAS3 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of PIAS3 over-expressed 293 cell line, cotransfected with PIAS3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PIAS3 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)
Related Product Information for anti-PIAS3 antibody
Functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. Plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway and the steroid hormone signaling pathway. The effects of this transcriptional coregulation, transactivation or silencing, may vary depending upon the biological context.
Product Categories/Family for anti-PIAS3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68,017 Da
NCBI Official Full Name
E3 SUMO-protein ligase PIAS3
NCBI Official Synonym Full Names
protein inhibitor of activated STAT, 3
NCBI Official Symbol
PIAS3
NCBI Official Synonym Symbols
ZMIZ5
NCBI Protein Information
E3 SUMO-protein ligase PIAS3; zinc finger, MIZ-type containing 5; protein inhibitor of activated STAT protein 3
UniProt Protein Name
E3 SUMO-protein ligase PIAS3
Protein Family
UniProt Gene Name
PIAS3
UniProt Entry Name
PIAS3_HUMAN

NCBI Description

This gene encodes a member of the PIAS [protein inhibitor of activated STAT (signal transducer and activator of transcription)] family of transcriptional modulators. The protein functions as a SUMO (small ubiquitin-like modifier)-E3 ligase which catalyzes the covalent attachment of a SUMO protein to specific target substrates. It directly binds to several transcription factors and either blocks or enhances their activity. Alternatively spliced transcript variants of this gene have been identified, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

PIAS3: Functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. Plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway and the steroid hormone signaling pathway. Involved in regulating STAT3 signaling via inhibiting STAT3 DNA-binding and suppressing cell growth. Monomer. Binds SUMO1 and UBE2I. Interacts with BCL11A, HMGA2, IRF1, MITF and NCOA2. Interacts with STAT5; the interaction occurs on stimulation by PRL. Interacts with GFI1; the interaction relieves the inhibitory effect of PIAS3 on STAT3- mediated transcriptional activity. Interacts with AR, PLAG1 and ZFHX3. Interacts with STAT3; the interaction occurs on stimulation by IL6, CNTF or OSM and inhibits the DNA binding activity of STAT3. By dihydrotestosterone (DHT) in prostate cancer cells. Isoform 1 is expressed in most tissues except thymus and small intestine. Isoform 3 is expressed only in brain, heart, thymus, muscle, lung, testis, lactating breast and embryonic stem cells. Belongs to the PIAS family.

Protein type: EC 6.3.2.-; SUMO conjugating system; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: cytoplasm; dendrite; synapse; nucleus

Molecular Function: protein C-terminus binding; protein binding; enzyme binding; potassium channel regulator activity; zinc ion binding; protein N-terminus binding; SUMO ligase activity; ligase activity

Biological Process: positive regulation of protein sumoylation; protein sumoylation; transcription, DNA-dependent; regulation of transcription, DNA-dependent; response to hormone stimulus; positive regulation of membrane potential

Research Articles on PIAS3

Similar Products

Product Notes

The PIAS3 pias3 (Catalog #AAA6159453) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PIAS3 (E3 SUMO-protein Ligase PIAS3, Protein Inhibitor of Activated STAT Protein 3, FLJ14651, ZMIZ5) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PIAS3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PIAS3 pias3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PIAS3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.