Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.9kD).)

Mouse anti-Human PIAS2 Monoclonal Antibody | anti-PIAS2 antibody

PIAS2 (E3 SUMO-protein Ligase PIAS2, Androgen Receptor-interacting Protein 3, ARIP3, DAB2-interacting Protein, DIP, Msx-interacting Zinc Finger Protein, Miz1, PIAS-NY Protein, Protein Inhibitor of Activated STAT x, Protein Inhibitor of Activated STAT2, PI

Gene Names
PIAS2; DIP; MIZ1; SIZ2; ARIP3; PIASX; ZMIZ4
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PIAS2; Monoclonal Antibody; PIAS2 (E3 SUMO-protein Ligase PIAS2; Androgen Receptor-interacting Protein 3; ARIP3; DAB2-interacting Protein; DIP; Msx-interacting Zinc Finger Protein; Miz1; PIAS-NY Protein; Protein Inhibitor of Activated STAT x; Protein Inhibitor of Activated STAT2; PI; anti-PIAS2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Clone Number
1F7
Specificity
Recognizes human PIAS2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-PIAS2 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa385-474 from PIAS2 (NP_004662) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
CPVCDKKAAYESLILDGLFMEILNDCSDVDEIKFQEDGSWCPMRPKKEAMKVSSQPCTKIESSSVLSKPCSVTVASEASKKKVDVIDLT
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.9kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.9kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PIAS2 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to PIAS2 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged PIAS2 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PIAS2 is ~0.3ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of PIAS2 over-expressed 293 cell line, cotransfected with PIAS2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PIAS2 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of PIAS2 over-expressed 293 cell line, cotransfected with PIAS2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PIAS2 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between TP53 and PIAS2 HeLa cells were stained with TP53 rabbit purified polyclonal 1:1200 and PIAS2 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between TP53 and PIAS2 HeLa cells were stained with TP53 rabbit purified polyclonal 1:1200 and PIAS2 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Product Categories/Family for anti-PIAS2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68kDa
NCBI Official Full Name
E3 SUMO-protein ligase PIAS2 isoform beta
NCBI Official Synonym Full Names
protein inhibitor of activated STAT 2
NCBI Official Symbol
PIAS2
NCBI Official Synonym Symbols
DIP; MIZ1; SIZ2; ARIP3; PIASX; ZMIZ4
NCBI Protein Information
E3 SUMO-protein ligase PIAS2
UniProt Protein Name
E3 SUMO-protein ligase PIAS2
Protein Family
UniProt Gene Name
PIAS2
UniProt Synonym Gene Names
PIASX; ARIP3; DIP; Miz1
UniProt Entry Name
PIAS2_HUMAN

NCBI Description

This gene encodes a member of the protein inhibitor of activated STAT family, which function as SUMO E3 ligases and play important roles in many cellular processes by mediating the sumoylation of target proteins. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. Isoforms of the encoded protein enhance the sumoylation of specific target proteins including the p53 tumor suppressor protein, c-Jun, and the androgen receptor. A pseudogene of this gene is located on the short arm of chromosome 4. The symbol MIZ1 has also been associated with ZBTB17 which is a different gene located on chromosome 1. [provided by RefSeq, Aug 2017]

Uniprot Description

PIAS2: Functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. Plays a crucial role as a transcriptional coregulator in various cellular pathways, including the STAT pathway, the p53 pathway and the steroid hormone signaling pathway. The effects of this transcriptional coregulation, transactivation or silencing may vary depending upon the biological context and the PIAS2 isoform studied. However, it seems to be mostly involved in gene silencing. Binds to sumoylated ELK1 and enhances its transcriptional activity by preventing recruitment of HDAC2 by ELK1, thus reversing SUMO-mediated repression of ELK1 transactivation activity. Isoform PIAS2-beta, but not isoform PIAS2-alpha, promotes MDM2 sumoylation. Isoform PIAS2-alpha promotes PARK7 sumoylation. Isoform PIAS2-beta promotes NCOA2 sumoylation more efficiently than isoform PIAS2- alpha. Belongs to the PIAS family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 6.3.2.-; Nuclear receptor co-regulator; SUMO conjugating system; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 18q21.1

Cellular Component: PML body; nuclear speck; nucleus

Molecular Function: protein binding; androgen receptor binding; DNA binding; zinc ion binding; ubiquitin protein ligase binding; transcription coactivator activity; transcription factor binding; ligase activity

Biological Process: protein sumoylation; transcription, DNA-dependent; regulation of osteoblast differentiation; negative regulation of transcription factor activity; positive regulation of transcription, DNA-dependent; androgen receptor signaling pathway; positive regulation of transcription from RNA polymerase II promoter

Research Articles on PIAS2

Similar Products

Product Notes

The PIAS2 pias2 (Catalog #AAA6159452) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PIAS2 (E3 SUMO-protein Ligase PIAS2, Androgen Receptor-interacting Protein 3, ARIP3, DAB2-interacting Protein, DIP, Msx-interacting Zinc Finger Protein, Miz1, PIAS-NY Protein, Protein Inhibitor of Activated STAT x, Protein Inhibitor of Activated STAT2, PI reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PIAS2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PIAS2 pias2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PIAS2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.