Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human, Rat PHOSPHO1 Monoclonal Antibody | anti-PHOSPHO1 antibody

PHOSPHO1 (Phosphoethanolamine/Phosphocholine Phosphatase) APC

Reactivity
Human, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PHOSPHO1; Monoclonal Antibody; PHOSPHO1 (Phosphoethanolamine/Phosphocholine Phosphatase) APC; anti-PHOSPHO1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4B2
Specificity
Recognizes human PHOSPHO1. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-PHOSPHO1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa168-267 from human PHOSPHO1 (NP_848595) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
CARCPANMCKHKVLSDYLRERAHDGVHFERLFYVGDGANDFCPMGLLAGGDVAFPRRGYPMHRLIQEAQKAEPSSFRASVVPWETAADVRLHLQQVLKS
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(PHOSPHO1 monoclonal antibody. Western Blot analysis of PHOSPHO1 expression in PC-12.)

Western Blot (WB) (PHOSPHO1 monoclonal antibody. Western Blot analysis of PHOSPHO1 expression in PC-12.)

Western Blot (WB)

(PHOSPHO1 monoclonal antibody Western Blot analysis of PHOSPHO1 expression in Jurkat.)

Western Blot (WB) (PHOSPHO1 monoclonal antibody Western Blot analysis of PHOSPHO1 expression in Jurkat.)

Testing Data

(Detection limit for recombinant GST tagged PHOSPHO1 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PHOSPHO1 is ~1ng/ml as a capture antibody.)
Related Product Information for anti-PHOSPHO1 antibody
Phosphatase that has a high activity toward phosphoethanolamine (PEA) and phosphocholine (PCho). Involved in the generation of inorganic phosphate for bone mineralization.
Product Categories/Family for anti-PHOSPHO1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32.2 kDa (291aa) confirmed by MALDI-TOF
NCBI Official Full Name
phosphoethanolamine/phosphocholine phosphatase isoform 2
NCBI Official Synonym Full Names
phosphoethanolamine/phosphocholine phosphatase
NCBI Official Symbol
PHOSPHO1
NCBI Protein Information
phosphoethanolamine/phosphocholine phosphatase
UniProt Protein Name
Phosphoethanolamine/phosphocholine phosphatase
Protein Family
UniProt Gene Name
PHOSPHO1
UniProt Entry Name
PHOP1_HUMAN

Uniprot Description

PHOSPHO1: Phosphatase that has a high activity toward phosphoethanolamine (PEA) and phosphocholine (PCho). Involved in the generation of inorganic phosphate for bone mineralization. Belongs to the HAD-like hydrolase superfamily. PHOSPHO family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Phosphatase; EC 3.1.3.75; Lipid Metabolism - glycerophospholipid

Chromosomal Location of Human Ortholog: 17q21.32

Cellular Component: cytosol

Molecular Function: pyrophosphatase activity; metal ion binding; phosphoric monoester hydrolase activity

Biological Process: dephosphorylation; phospholipid metabolic process; phosphatidylethanolamine biosynthetic process; glycerophospholipid biosynthetic process; phosphatidylcholine biosynthetic process; regulation of bone mineralization; endochondral ossification

Research Articles on PHOSPHO1

Similar Products

Product Notes

The PHOSPHO1 phospho1 (Catalog #AAA6138225) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PHOSPHO1 (Phosphoethanolamine/Phosphocholine Phosphatase) APC reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PHOSPHO1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PHOSPHO1 phospho1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PHOSPHO1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.