Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of PHGDH expression in transfected 293T cell line by PHGDH monoclonal antibody. Lane 1: PHGDH transfected lysate (56.7kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human PHGDH Monoclonal Antibody | anti-PHGDH antibody

PHGDH (D-3-phosphoglycerate Dehydrogenase, 3-PGDH, PGDH3, MGC3017, SERA) (AP)

Gene Names
PHGDH; NLS; PDG; PGD; NLS1; PGAD; PGDH; SERA; 3PGDH; 3-PGDH; PHGDHD; HEL-S-113
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PHGDH; Monoclonal Antibody; PHGDH (D-3-phosphoglycerate Dehydrogenase; 3-PGDH; PGDH3; MGC3017; SERA) (AP); anti-PHGDH antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4A3-1D6
Specificity
Recognizes human PHGDH.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
1968
Applicable Applications for anti-PHGDH antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
Application Notes
IHC-P: 1-10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-533 from human PHGDH (AAH11262) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAFANLRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTIGYDPIISPEVSASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPAAPGEQGFGECLLAVALAGAPYQAVGLVQGTTPVLQGLNGAVFRPEVPLRRDLPLLLFRTQTSDPAMLPTMIGLLAEAGVRLLSYQTSLVSDGETWHVMGISSLLPSLEAWKQHVTEAFQFHF
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PHGDH expression in transfected 293T cell line by PHGDH monoclonal antibody. Lane 1: PHGDH transfected lysate (56.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PHGDH expression in transfected 293T cell line by PHGDH monoclonal antibody. Lane 1: PHGDH transfected lysate (56.7kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PHGDH on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 1-10ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to PHGDH on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 1-10ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PHGDH on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to PHGDH on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PHGDH on HeLa cell. [antibody concentration 1-10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to PHGDH on HeLa cell. [antibody concentration 1-10ug/ml])

Immunoprecipitation (IP)

(Immunoprecipitation of PHGDH transfected lysate using PHGDH monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PHGDH rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of PHGDH transfected lysate using PHGDH monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PHGDH rabbit polyclonal antibody.)

Western Blot (WB)

(PHGDH monoclonal antibody. Western Blot analysis of PHGDH expression in human liver.)

Western Blot (WB) (PHGDH monoclonal antibody. Western Blot analysis of PHGDH expression in human liver.)

Western Blot (WB)

(Western Blot detection against Immunogen (84.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (84.74kD).)
Product Categories/Family for anti-PHGDH antibody
References
1. Enhanced serine production by bone metastatic breast cancer cells stimulates osteoclastogenesis. Pollari S, Kakonen SM, Edgren H, Wolf M, Kohonen P, Sara H, Guise T, Nees M, Kallioniemi O.Breast Cancer Res Treat. 2010 Mar 30.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens phosphoglycerate dehydrogenase, mRNA
NCBI Official Synonym Full Names
phosphoglycerate dehydrogenase
NCBI Official Symbol
PHGDH
NCBI Official Synonym Symbols
NLS; PDG; PGD; NLS1; PGAD; PGDH; SERA; 3PGDH; 3-PGDH; PHGDHD; HEL-S-113
NCBI Protein Information
D-3-phosphoglycerate dehydrogenase

NCBI Description

This gene encodes the enzyme which is involved in the early steps of L-serine synthesis in animal cells. L-serine is required for D-serine and other amino acid synthesis. The enzyme requires NAD/NADH as a cofactor and forms homotetramers for activity. Mutations in this gene have been found in a family with congenital microcephaly, psychomotor retardation and other symptoms. Multiple alternatively spliced transcript variants have been found, however the full-length nature of most are not known. [provided by RefSeq, Aug 2011]

Research Articles on PHGDH

Similar Products

Product Notes

The PHGDH (Catalog #AAA6132915) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PHGDH (D-3-phosphoglycerate Dehydrogenase, 3-PGDH, PGDH3, MGC3017, SERA) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PHGDH can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB). IHC-P: 1-10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PHGDH for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PHGDH, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.