Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged PHF5A is approximately 1ng/ml as a capture antibody.)

Mouse PHF5A Monoclonal Antibody | anti-PHF5A antibody

PHF5A (PHD Finger Protein 5A, INI, MGC1346, SF3b14b, bK223H9.2) (PE)

Gene Names
PHF5A; INI; Rds3; SF3B7; SAP14b; SF3b14b; bK223H9.2
Applications
Western Blot
Purity
Purified
Synonyms
PHF5A; Monoclonal Antibody; PHF5A (PHD Finger Protein 5A; INI; MGC1346; SF3b14b; bK223H9.2) (PE); PHD Finger Protein 5A; bK223H9.2; anti-PHF5A antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2H7
Specificity
Recognizes PHF5A.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-PHF5A antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PHF5A (NP_116147, 1aa-110aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged PHF5A is approximately 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PHF5A is approximately 1ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of PHF5A expression in transfected 293T cell line by PHF5A monoclonal antibody (M01), clone 2H7.Lane 1: PHF5A transfected lysate (12.4 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PHF5A expression in transfected 293T cell line by PHF5A monoclonal antibody (M01), clone 2H7.Lane 1: PHF5A transfected lysate (12.4 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-PHF5A antibody
This gene encodes a subunit of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence-independent manner and may anchor the U2 snRNP to the pre-mRNA. The protein encoded by this gene contains a PHD-finger-like domain that is flanked by highly basic N- and C-termini. This protein belongs to the PHD-finger superfamily and may act as a chromatin-associated protein. This gene has several pseudogenes on different chromosomes. [provided by RefSeq]
Product Categories/Family for anti-PHF5A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14.8kDa (133aa), confirmed by MALDI-TOF
NCBI Official Full Name
PHD finger-like domain-containing protein 5A
NCBI Official Synonym Full Names
PHD finger protein 5A
NCBI Official Symbol
PHF5A
NCBI Official Synonym Symbols
INI; Rds3; SF3B7; SAP14b; SF3b14b; bK223H9.2
NCBI Protein Information
PHD finger-like domain-containing protein 5A
UniProt Protein Name
PHD finger-like domain-containing protein 5A
UniProt Gene Name
PHF5A
UniProt Synonym Gene Names
PHD finger-like domain protein 5A; SF3b14b
UniProt Entry Name
PHF5A_HUMAN

NCBI Description

This gene encodes a subunit of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence-independent manner and may anchor the U2 snRNP to the pre-mRNA. The protein encoded by this gene contains a PHD-finger-like domain that is flanked by highly basic N- and C-termini. This protein belongs to the PHD-finger superfamily and may act as a chromatin-associated protein. This gene has several pseudogenes on different chromosomes. [provided by RefSeq, Jul 2008]

Uniprot Description

PHF5A: Acts as a transcriptional regulator by binding to the GJA1/Cx43 promoter and enhancing its up-regulation by ESR1/ER- alpha. Also involved in pre-mRNA splicing. Belongs to the PHF5 family.

Protein type: RNA-binding; RNA splicing

Chromosomal Location of Human Ortholog: 22q13.2

Cellular Component: nucleoplasm; nuclear matrix; nuclear speck; snRNP U2; U12-dependent spliceosome

Molecular Function: DNA binding; transcription factor activity

Biological Process: nuclear mRNA splicing, via spliceosome; transcription, DNA-dependent; RNA splicing; positive regulation of transcription, DNA-dependent; gene expression

Research Articles on PHF5A

Similar Products

Product Notes

The PHF5A phf5a (Catalog #AAA6187903) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PHF5A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PHF5A phf5a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PHF5A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.