Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human PHF21A Monoclonal Antibody | anti-PHF21A antibody

PHF21A (BHC80, KIAA1696, PHD Finger Protein 21A, BHC80a, BRAF35-HDAC Complex Protein BHC80) (AP)

Gene Names
PHF21A; BHC80; BM-006
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PHF21A; Monoclonal Antibody; PHF21A (BHC80; KIAA1696; PHD Finger Protein 21A; BHC80a; BRAF35-HDAC Complex Protein BHC80) (AP); anti-PHF21A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5A6
Specificity
Recognizes human PHF21A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-PHF21A antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa331-431 from human PHF21A (NP_057705) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KQTVKSHTETDEKQTESRTITPPAAPKPKREENPQKLAFMVSLGLVTHDHLEEIQSKRQERKRRTTANPVYSGAVFEPERKKSAVTYLNSTMHPGTRKRA
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Testing Data

(Detection limit for recombinant GST tagged PHF21A is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PHF21A is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-PHF21A antibody
The PHF21A gene encodes BHC80, a component of a BRAF35 (MIM 605535)/histone deacetylase (HDAC; see MIM 601241) complex (BHC) that mediates repression of neuron-specific genes through the cis-regulatory element known as repressor element-1 (RE1) or neural restrictive silencer (NRS) (Hakimi et al., 2002 [PubMed 12032298]).
Product Categories/Family for anti-PHF21A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70kDa
NCBI Official Full Name
PHD finger protein 21A isoform b
NCBI Official Synonym Full Names
PHD finger protein 21A
NCBI Official Symbol
PHF21A
NCBI Official Synonym Symbols
BHC80; BM-006
NCBI Protein Information
PHD finger protein 21A
UniProt Protein Name
PHD finger protein 21A
Protein Family
UniProt Gene Name
PHF21A
UniProt Synonym Gene Names
BHC80; KIAA1696; BM-006
UniProt Entry Name
PF21A_HUMAN

NCBI Description

The PHF21A gene encodes BHC80, a component of a BRAF35 (MIM 605535)/histone deacetylase (HDAC; see MIM 601241) complex (BHC) that mediates repression of neuron-specific genes through the cis-regulatory element known as repressor element-1 (RE1) or neural restrictive silencer (NRS) (Hakimi et al., 2002 [PubMed 12032298]).[supplied by OMIM, Nov 2010]

Research Articles on PHF21A

Similar Products

Product Notes

The PHF21A phf21a (Catalog #AAA6132913) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PHF21A (BHC80, KIAA1696, PHD Finger Protein 21A, BHC80a, BRAF35-HDAC Complex Protein BHC80) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PHF21A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PHF21A phf21a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PHF21A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.