Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged PHB2 is 1ng/ml as a capture antibody.)

Mouse anti-Human PHB2 Monoclonal Antibody | anti-PHB2 antibody

PHB2 (Prohibitin-2, B Cell Receptor-associated Protein BAP37, D-prohibitin, Repressor of Estrogen receptor activity, BAP, REA) (PE)

Gene Names
PHB2; BAP; REA; p22; hBAP; Bap37; BCAP37; PNAS-141
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PHB2; Monoclonal Antibody; PHB2 (Prohibitin-2; B Cell Receptor-associated Protein BAP37; D-prohibitin; Repressor of Estrogen receptor activity; BAP; REA) (PE); anti-PHB2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2D3
Specificity
Recognizes human PHB2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-PHB2 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length recombinant corresponding to aa37-300 from PHB2 (AAH14766) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGS
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged PHB2 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PHB2 is 1ng/ml as a capture antibody.)
Related Product Information for anti-PHB2 antibody
PHB2 acts as a mediator of transcriptional repression by nuclear hormone receptors via recruitment of histone deacetylases. This protein functions as an estrogen receptor (ER)-selective coregulator that potentiates the inhibitory activities of antiestrogens and represses the activity of estrogens. It competes with NCOA1 for modulation of ER transcriptional activity. It is probably involved in regulating mitochondrial respiration activity and in aging.
Product Categories/Family for anti-PHB2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
29,044 Da
NCBI Official Full Name
Homo sapiens prohibitin 2, mRNA
NCBI Official Synonym Full Names
prohibitin 2
NCBI Official Symbol
PHB2
NCBI Official Synonym Symbols
BAP; REA; p22; hBAP; Bap37; BCAP37; PNAS-141
NCBI Protein Information
prohibitin-2
Protein Family

Research Articles on PHB2

Similar Products

Product Notes

The PHB2 (Catalog #AAA6159423) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PHB2 (Prohibitin-2, B Cell Receptor-associated Protein BAP37, D-prohibitin, Repressor of Estrogen receptor activity, BAP, REA) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PHB2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PHB2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PHB2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.