Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.18kD).)

Mouse anti-Human PGA5 Monoclonal Antibody | anti-PGA5 antibody

PGA5 (Pepsin A-5, Pepsinogen-5) (MaxLight 650)

Gene Names
PGA5; Pg5
Reactivity
Human
Applications
Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PGA5; Monoclonal Antibody; PGA5 (Pepsin A-5; Pepsinogen-5) (MaxLight 650); anti-PGA5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4G9
Specificity
Recognizes human PGA5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Sequence Length
388
Applicable Applications for anti-PGA5 antibody
FLISA, Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa203-306 from human PGA5 (NM_014224, NP_055039) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
WNQGLVSQDLFSVYLSADDKSGSVVIFGGIDSSYYTGSLNWVPVTVEGYWQITVDSITMNGETIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGASENSDGD
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.18kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.18kD).)

Western Blot (WB)

(Western Blot analysis of PGA5 expression in HepG2 using 131197.)

Western Blot (WB) (Western Blot analysis of PGA5 expression in HepG2 using 131197.)

Immunofluorescence (IF)

(Immunofluorescence on HeLa cells usong 131197 (10ug/ml).)

Immunofluorescence (IF) (Immunofluorescence on HeLa cells usong 131197 (10ug/ml).)
Product Categories/Family for anti-PGA5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
pepsin A-5 preproprotein
NCBI Official Synonym Full Names
pepsinogen A5
NCBI Official Symbol
PGA5
NCBI Official Synonym Symbols
Pg5
NCBI Protein Information
pepsin A-5
UniProt Protein Name
Pepsin A-5
Protein Family
UniProt Gene Name
PGA5
UniProt Entry Name
PEPA5_HUMAN

NCBI Description

This gene encodes a protein precursor of the digestive enzyme pepsin, a member of the peptidase A1 family of endopeptidases. The encoded precursor is secreted by gastric chief cells and undergoes autocatalytic cleavage in acidic conditions to form the active enzyme, which functions in the digestion of dietary proteins. This gene is found in a cluster of related genes on chromosome 11, each of which encodes one of multiple pepsinogens. Pepsinogen levels in serum may serve as a biomarker for atrophic gastritis and gastric cancer. [provided by RefSeq, Jul 2015]

Uniprot Description

PGA5: Shows particularly broad specificity; although bonds involving phenylalanine and leucine are preferred, many others are also cleaved to some extent. Belongs to the peptidase A1 family.

Protein type: EC 3.4.23.1; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 11q13

Molecular Function: aspartic-type endopeptidase activity

Biological Process: digestion; proteolysis

Research Articles on PGA5

Similar Products

Product Notes

The PGA5 pga5 (Catalog #AAA6223783) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PGA5 (Pepsin A-5, Pepsinogen-5) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PGA5 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PGA5 pga5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PGA5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.