Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human Period Clock Protein 2 Monoclonal Antibody | anti-PER2 antibody

Period Clock Protein 2 (Period Circadian Protein Homolog 2, PER2, hPER2, Circadian Clock Protein PERIOD 2, FASPS, KIAA0347) (MaxLight 405)

Gene Names
PER2; FASPS; FASPS1
Reactivity
Human
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Period Clock Protein 2; Monoclonal Antibody; Period Clock Protein 2 (Period Circadian Protein Homolog 2; PER2; hPER2; Circadian Clock Protein PERIOD 2; FASPS; KIAA0347) (MaxLight 405); anti-PER2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
5C10
Specificity
Recognizes human PER2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-PER2 antibody
FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-101 from PER2 (NP_073728) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MNGYAEFPPSPSNPTKEPVEPQPSQVPLQEDVDMSSGSSGHETNENCSTGRDSQGSDCDDSGKELGM
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-PER2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
136kDa
NCBI Official Full Name
period circadian protein homolog 2
NCBI Official Synonym Full Names
period circadian regulator 2
NCBI Official Symbol
PER2
NCBI Official Synonym Symbols
FASPS; FASPS1
NCBI Protein Information
period circadian protein homolog 2
UniProt Protein Name
Period circadian protein homolog 2
Protein Family
UniProt Gene Name
PER2
UniProt Synonym Gene Names
KIAA0347; hPER2
UniProt Entry Name
PER2_HUMAN

NCBI Description

This gene is a member of the Period family of genes and is expressed in a circadian pattern in the suprachiasmatic nucleus, the primary circadian pacemaker in the mammalian brain. Genes in this family encode components of the circadian rhythms of locomotor activity, metabolism, and behavior. This gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene may increase the risk of getting certain cancers and have been linked to sleep disorders. [provided by RefSeq, Jan 2014]

Uniprot Description

PER2: a transcription factor belonging to the basic helix-loop-helix (bHLH) family. A member of the Period family of genes and is expressed in a circadian pattern in the suprachiasmatic nucleus, the primary circadian pacemaker in the mammalian brain. Genes in this family encode components of the circadian rhythms of locomotor activity, metabolism, and behavior. Circadian expression in the suprachiasmatic nucleus continues in constant darkness, and a shift in the light/dark cycle evokes a proportional shift of gene expression in the suprachiasmatic nucleus. Behaves as a negative element in circadian transcriptional loop. Does not appear to bind DNA, suggesting indirect transcriptional inhibition. Expression oscillates with a 24 hr rhythm in the suprachiasmatic nucleus and the whole eyes. Oscillations are maintained under constant darkness and are responsive to changes of the light/dark cycles. There is a 4 hour time delay between per1 and per2 oscillations. The expression rhythms appear to originate from retina.

Protein type: Nucleolus; Transcription factor; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 2q37.3

Cellular Component: nucleoplasm; perinuclear region of cytoplasm; cytoplasm; nucleolus; nucleus

Molecular Function: ubiquitin binding; signal transducer activity; protein binding; histone deacetylase binding; transcription coactivator activity; kinase binding; nuclear hormone receptor binding

Biological Process: circadian rhythm; glycogen biosynthetic process; transcription, DNA-dependent; regulation of cell cycle; negative regulation of transcription from RNA polymerase II promoter; fatty acid metabolic process; regulation of circadian rhythm; signal transduction; regulation of glutamate uptake during transmission of nerve impulse; gluconeogenesis; regulation of neurogenesis; regulation of vasoconstriction; white fat cell differentiation; lactate biosynthetic process; negative regulation of protein ubiquitination; negative regulation of circadian rhythm; circadian regulation of gene expression; negative regulation of transcription, DNA-dependent; regulation of insulin secretion

Disease: Advanced Sleep Phase Syndrome, Familial, 1

Research Articles on PER2

Similar Products

Product Notes

The PER2 per2 (Catalog #AAA6191744) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Period Clock Protein 2 (Period Circadian Protein Homolog 2, PER2, hPER2, Circadian Clock Protein PERIOD 2, FASPS, KIAA0347) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Period Clock Protein 2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PER2 per2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Period Clock Protein 2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.