Mouse anti-Human PDX1 Monoclonal Antibody | anti-PDX1 antibody

PDX1 (Pancreas/Duodenum Homeobox Protein 1, PDX-1, Glucose-sensitive Factor, GSF, Insulin Promoter Factor 1, IPF-1, Insulin Upstream Factor 1, IUF-1, Islet/Duodenum Homeobox-1, IDX-1, Somatostatin-transactivating Factor 1, STF-1, IPF1, STF1) (Biotin)

Cat. Num. AAA6143474

• Gene Names: PDX1; GSF; IPF1; IUF1; IDX-1; MODY4; PDX-1; STF-1; PAGEN1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PDX1; Monoclonal Antibody; PDX1 (Pancreas/Duodenum Homeobox Protein 1; PDX-1; Glucose-sensitive Factor; GSF; Insulin Promoter Factor 1; IPF-1; Insulin Upstream Factor 1; IUF-1; Islet/Duodenum Homeobox-1; IDX-1; Somatostatin-transactivating Factor 1; STF-1; IPF1; STF1) (Biotin); anti-PDX1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b, lambda
• Clone Number: 3F10
• Specificity: Recognizes human IPF1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-PDX1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Recombinant corresponding to aa109-208 from human IPF1 (NP_000200) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LEEPNRVQLPFPWMKSTKAHAWKGQWAGGAYAAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKK
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Related Product Information for anti-PDX1 antibody

PDX1, also known as Pancreas/duodenum homeobox protein 1, is a nuclear protein belonging to the Antp homeobox family and IPF1/XlHbox-8 subfamily with a homeobox DNA-binding domain. It activates insulin, somatostatin, glucokinase, islet amyloid polypeptide and glucose transporter type 2 gene transcription and is particularly involved in glucose-dependent regulation of insulin gene transcription. During development, PDX1 specifies the early pancreatic epithelium, permitting its proliferation, branching and subsequent differentiation. Expression is common in duodenum and pancreas (Langerhans islet beta cells and small subsets of endocrine non-beta-cells, at low levels in acinar cells). Defects in PDX1 are associated with pancreatic agenesis, maturity onset diabetes noninsulin-dependent diabetes mellitus (NIDDM), also known as diabetes mellitus type II, and maturity onset diabetes of the young type 4 (MODY4).

Product Categories/Family for anti-PDX1 antibody

Antibodies; Transcription Factors; Homeobox (HOX)

NCBI and Uniprot Product Information

• NCBI GI #: 4557673
• NCBI GeneID: 3651
• NCBI Accession #: NP_000200
• NCBI GenBank Nucleotide #: NM_000209
• UniProt Accession #: P52945; O60594; Q5VYW2
• Molecular Weight: 30,771 Da
• NCBI Official Full Name: pancreas/duodenum homeobox protein 1
• NCBI Official Synonym Full Names: pancreatic and duodenal homeobox 1
• NCBI Official Symbol: PDX1
• NCBI Official Synonym Symbols: GSF; IPF1; IUF1; IDX-1; MODY4; PDX-1; STF-1; PAGEN1
• NCBI Protein Information: pancreas/duodenum homeobox protein 1
• UniProt Protein Name: Pancreas/duodenum homeobox protein 1
• Protein Family: Pyridoxal 5'-phosphate synthase
• UniProt Gene Name: PDX1
• UniProt Synonym Gene Names: IPF1; STF1; PDX-1; GSF; IPF-1; IUF-1; IDX-1; STF-1
• UniProt Entry Name: PDX1_HUMAN

NCBI Description

The protein encoded by this gene is a transcriptional activator of several genes, including insulin, somatostatin, glucokinase, islet amyloid polypeptide, and glucose transporter type 2. The encoded nuclear protein is involved in the early development of the pancreas and plays a major role in glucose-dependent regulation of insulin gene expression. Defects in this gene are a cause of pancreatic agenesis, which can lead to early-onset insulin-dependent diabetes mellitus (NIDDM), as well as maturity onset diabetes of the young type 4 (MODY4). [provided by RefSeq, Jul 2008]

Uniprot Description

PDX1: Activates insulin, somatostatin, glucokinase, islet amyloid polypeptide and glucose transporter type 2 gene transcription. Particularly involved in glucose-dependent regulation of insulin gene transcription. Binds preferentially the DNA motif 5'-[CT]TAAT[TG]-3'. During development, specifies the early pancreatic epithelium, permitting its proliferation, branching and subsequent differentiation. At adult stage, required for maintaining the hormone-producing phenotype of the beta-cell. Interacts with the basic helix-loop-helix domains of TCF3(E47) and NEUROD1 and with HMG-I(Y). Interacts with SPOP. Interacts with the methyltransferase SETD7. Duodenum and pancreas (Langerhans islet beta cells and small subsets of endocrine non-beta-cells, at low levels in acinar cells). Belongs to the Antp homeobox family. IPF1/XlHbox-8 subfamily.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 13q12.1

Cellular Component: nucleus; cytosol

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; protein heterodimerization activity; protein complex binding; chromatin binding; transcription factor binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; response to nicotine; central nervous system development; response to glucocorticoid stimulus; exocrine pancreas development; negative regulation of transcription from RNA polymerase II promoter; glucose homeostasis; response to chlorate; response to vitamin; negative regulation of cell proliferation; detection of glucose; morphogenesis of embryonic epithelium; positive regulation of cell proliferation; response to wounding; response to iron(II) ion; positive regulation of DNA binding; response to drug; organ regeneration; smoothened signaling pathway; generation of precursor metabolites and energy; organ senescence; positive regulation of insulin secretion; glucose metabolic process; stem cell differentiation; liver development; endocrine pancreas development; organ morphogenesis; response to leucine; gut development; insulin secretion; response to cytokine stimulus; positive regulation of transcription from RNA polymerase II promoter; nitric oxide mediated signal transduction

Disease: Maturity-onset Diabetes Of The Young, Type 4; Diabetes Mellitus, Permanent Neonatal; Pancreatic Agenesis 1; Diabetes Mellitus, Noninsulin-dependent