Mouse anti-Human PDK3 Monoclonal Antibody | anti-PDK3 antibody

PDK3 (PDHK3, [Pyruvate Dehydrogenase [Lipoamide]] Kinase Isozyme 3, Mitochondrial, Pyruvate Dehydrogenase Kinase Isoform 3) (AP)

Cat. Num. AAA6132862

• Gene Names: PDK3; CMTX6; GS1-358P8.4
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PDK3; Monoclonal Antibody; PDK3 (PDHK3; [Pyruvate Dehydrogenase [Lipoamide]] Kinase Isozyme 3; Mitochondrial; Pyruvate Dehydrogenase Kinase Isoform 3) (AP); anti-PDK3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2B11
• Specificity: Recognizes human PDK3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-PDK3 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa174-263 from human PDK3 (AAH15948) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GDTNPVHPKHIGSIDPTCNVADVVKDAYETAKMLCEQYYLVAPELEVEEFNAKAPDKPIQVVYVPSHLFHMLFELFKNSMRATVELYEDR
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.31kD).)

Western Blot (WB)

(PDK3 monoclonal antibody Western Blot analysis of PDK3 expression in MCF-7.)

Western Blot (WB)

(Western Blot analysis of PDK3 expression in transfected 293T cell line by PDK3 monoclonal antibody. Lane 1: PDK3 transfected lysate (46.9kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged PDK3 is ~0.03ng/ml as a capture antibody.)

Related Product Information for anti-PDK3 antibody

The pyruvate dehydrogenase (PDH) complex is a nuclear-encoded mitochondrial multienzyme complex that catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2). It provides the primary link between glycolysis and the tricarboxylic acid (TCA) cycle, and thus is one of the major enzymes responsible for the regulation of glucose metabolism. The enzymatic activity of PDH is regulated by a phosphorylation/dephosphorylation cycle, and phosphorylation results in inactivation of PDH. The protein encoded by this gene is one of the three pyruvate dehydrogenase kinases that inhibits the PDH complex by phosphorylation of the E1 alpha subunit. This gene is predominantly expressed in the heart and skeletal muscles. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Product Categories/Family for anti-PDK3 antibody

Antibodies; Enzymes; Dehydrogenase

NCBI and Uniprot Product Information

• NCBI GI #: 16198532
• NCBI GeneID: 5165
• UniProt Accession #: Q15120; B4DXG6
• Molecular Weight: 48,043 Da
• NCBI Official Full Name: Homo sapiens pyruvate dehydrogenase kinase, isozyme 3, mRNA
• NCBI Official Synonym Full Names: pyruvate dehydrogenase kinase, isozyme 3
• NCBI Official Symbol: PDK3
• NCBI Official Synonym Symbols: CMTX6; GS1-358P8.4
• NCBI Protein Information: pyruvate dehydrogenase kinase, isozyme 3; [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 3, mitochondrial; pyruvate dehydrogenase kinase, isoenzyme 3; pyruvate dehydrogenase, lipoamide, kinase isozyme 3, mitochondrial
• UniProt Protein Name: [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 3, mitochondrial
• UniProt Gene Name: PDK3
• UniProt Synonym Gene Names: PDHK3
• UniProt Entry Name: PDK3_HUMAN

NCBI Description

The pyruvate dehydrogenase (PDH) complex is a nuclear-encoded mitochondrial multienzyme complex that catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2). It provides the primary link between glycolysis and the tricarboxylic acid (TCA) cycle, and thus is one of the major enzymes responsible for the regulation of glucose metabolism. The enzymatic activity of PDH is regulated by a phosphorylation/dephosphorylation cycle, and phosphorylation results in inactivation of PDH. The protein encoded by this gene is one of the three pyruvate dehydrogenase kinases that inhibits the PDH complex by phosphorylation of the E1 alpha subunit. This gene is predominantly expressed in the heart and skeletal muscles. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2010]

Uniprot Description

PDHK3: an atypical protein kinase associated with the mitochondrial matrix. The PDHKs play crucial roles in switching metabolic flux from oxidative phosphorylation towards glycolysis. PDHK3 is present in testes, kidney, and brain. Contains a HATPase_c catalytic domain, found in several ATP-binding proteins including protein histidine kinases (PHKs), PHDKs, DNA gyrase B, topoisomerases, heat shock proteins, and DNA mismatch repair proteins. PDHK regulates glucose oxidation through inhibitory phosphorylation of the E1 alpha subunit of the mitochondrial pyruvate dehydrogenase complex (PDHC) at any one of 3 inhibitory serine residues. Inhibitory sites 1, 2, and 3 correspond to S293, S300, and S232 in human PDHA1, respectively. Four PDHK isoenzymes have been described, each with different site specificity: all four phosphorylate sites 1 and 2 but at different rates; for site 1 PDHK2 >PDHK4 >PDHK1 >PDHK3; for site 2, PDHK3> PDHK4 > PDHK2 > PDHK1. Only PDHK1 phosphorylates site 3. PDHKs are recruited to the PDHC by binding to a lipoyl group covalently attached to the inner lipoyl domain of the E2 component. PDHA1 deficiency is the most common enzyme defect in patients with primary lactic acidosis. Suppression of PDH by PDHK inhibits the conversion of pyruvate to acetyl-CoA, attenuates mitochondrial respiration, and may contribute to the increased lactate production observed in many tumors. The PDH pathway is repressed in a majority of non-small cell lung carcinomas. Inhibited by AZD7545, dichloroacetate (DCA), and radicicol. Radicicol inhibits kinase activity by binding directly to the ATP-binding pocket of PDHK, similar to HSP90 from the same ATPase/kinase superfamily.

Protein type: Mitochondrial; Protein kinase, atypical; EC 2.7.11.2; Kinase, protein; ATYPICAL group; PDHK family

Chromosomal Location of Human Ortholog: Xp22.11

Cellular Component: mitochondrion; mitochondrial matrix

Molecular Function: protein serine/threonine kinase activity; protein binding; pyruvate dehydrogenase (acetyl-transferring) kinase activity; ATP binding; protein kinase activity

Biological Process: cellular metabolic process; peptidyl-serine phosphorylation; glucose metabolic process; regulation of acetyl-CoA biosynthetic process from pyruvate; pyruvate metabolic process