Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PDK3 monoclonal antibody (M03), clone 1G11 Western Blot analysis of PDK3 expression in HepG2.)

Mouse PDK3 Monoclonal Antibody | anti-PDK3 antibody

PDK3 (Pyruvate Dehydrogenase Kinase, Isozyme 3) (APC)

Gene Names
PDK3; CMTX6; GS1-358P8.4
Applications
Western Blot
Purity
Purified
Synonyms
PDK3; Monoclonal Antibody; PDK3 (Pyruvate Dehydrogenase Kinase; Isozyme 3) (APC); Pyruvate Dehydrogenase Kinase; Isozyme 3; anti-PDK3 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1
Clone Number
1G11
Specificity
Recognizes PDK3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
406
Applicable Applications for anti-PDK3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PDK3 (AAH15948, 174aa-263aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GDTNPVHPKHIGSIDPTCNVADVVKDAYETAKMLCEQYYLVAPELEVEEFNAKAPDKPIQVVYVPSHLFHMLFELFKNSMRATVELYEDR
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(PDK3 monoclonal antibody (M03), clone 1G11 Western Blot analysis of PDK3 expression in HepG2.)

Western Blot (WB) (PDK3 monoclonal antibody (M03), clone 1G11 Western Blot analysis of PDK3 expression in HepG2.)

Testing Data

(Detection limit for recombinant GST tagged PDK3 is approximately 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PDK3 is approximately 0.3ng/ml as a capture antibody.)
Related Product Information for anti-PDK3 antibody
Mouse monoclonal antibody raised against a partial recombinant PDK3.
Product Categories/Family for anti-PDK3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Pyruvate dehydrogenase kinase, isozyme 3
NCBI Official Synonym Full Names
pyruvate dehydrogenase kinase 3
NCBI Official Symbol
PDK3
NCBI Official Synonym Symbols
CMTX6; GS1-358P8.4
NCBI Protein Information
pyruvate dehydrogenase kinase, isozyme 3

NCBI Description

The pyruvate dehydrogenase (PDH) complex is a nuclear-encoded mitochondrial multienzyme complex that catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2). It provides the primary link between glycolysis and the tricarboxylic acid (TCA) cycle, and thus is one of the major enzymes responsible for the regulation of glucose metabolism. The enzymatic activity of PDH is regulated by a phosphorylation/dephosphorylation cycle, and phosphorylation results in inactivation of PDH. The protein encoded by this gene is one of the three pyruvate dehydrogenase kinases that inhibits the PDH complex by phosphorylation of the E1 alpha subunit. This gene is predominantly expressed in the heart and skeletal muscles. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2010]

Research Articles on PDK3

Similar Products

Product Notes

The PDK3 (Catalog #AAA6166722) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PDK3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PDK3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PDK3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.