Testing Data
(Detection limit for recombinant GST tagged PDIK1L is 0.3ng/ml as a capture antibody.)
Mouse anti-Human PDIK1L Monoclonal Antibody | anti-PDIK1L antibody
PDIK1L (Serine/Threonine-protein Kinase PDIK1L, PDLIM1-interacting Kinase 1-like, PDIK1L, CLIK1L, RP11-96L14.4, STK35L2) APC
Gene Names
PDIK1L; CLIK1L; STK35L2
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PDIK1L; Monoclonal Antibody; PDIK1L (Serine/Threonine-protein Kinase PDIK1L; PDLIM1-interacting Kinase 1-like; CLIK1L; RP11-96L14.4; STK35L2) APC; anti-PDIK1L antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4B7
Specificity
Recognizes human PDIK1L.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-PDIK1L antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa1-100 from human PDIK1L (NP_690048) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MVSSQPKYDLIREVGRGSYGVVYEAVIRKTSARVAVKKIRCHAPENVELALREFWALSSIKSQHPNVIHLEECILQKDGMVQKMSHGSNSSLYLQLVET
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged PDIK1L is 0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged PDIK1L is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-PDIK1L antibody
PDIK1L is expressed in liver, kidney, pancreas, spleen, thymus and prostate, contains 1 protein kinase domain which belongs to the Ser/Thr protein kinase family.
Product Categories/Family for anti-PDIK1L antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
serine/threonine-protein kinase PDIK1L
NCBI Official Synonym Full Names
PDLIM1 interacting kinase 1 like
NCBI Official Symbol
PDIK1L
NCBI Official Synonym Symbols
CLIK1L; STK35L2
NCBI Protein Information
serine/threonine-protein kinase PDIK1L
UniProt Protein Name
Serine/threonine-protein kinase PDIK1L
Protein Family
UniProt Gene Name
PDIK1L
UniProt Synonym Gene Names
CLIK1L
UniProt Entry Name
PDK1L_HUMAN
Uniprot Description
CLIK1L: Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
Protein type: Protein kinase, Other; EC 2.7.11.1; Kinase, protein; Protein kinase, Ser/Thr (non-receptor); Other group; NKF4 family
Chromosomal Location of Human Ortholog: 1p36.11
Cellular Component: nucleoplasm
Molecular Function: protein serine/threonine kinase activity; ATP binding
Biological Process: protein amino acid phosphorylation
Similar Products
Product Notes
The PDIK1L pdik1l (Catalog #AAA6138162) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PDIK1L (Serine/Threonine-protein Kinase PDIK1L, PDLIM1-interacting Kinase 1-like, PDIK1L, CLIK1L, RP11-96L14.4, STK35L2) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PDIK1L can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PDIK1L pdik1l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PDIK1L, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
