Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged PDIA4 is approximately 3ng/ml as a capture antibody.)

Mouse PDIA4 Monoclonal Antibody | anti-PDIA4 antibody

PDIA4 (Protein Disulfide Isomerase Family A, Member 4, ERP70, ERP72) (AP)

Gene Names
PDIA4; ERP70; ERP72; ERp-72
Applications
Western Blot
Purity
Purified
Synonyms
PDIA4; Monoclonal Antibody; PDIA4 (Protein Disulfide Isomerase Family A; Member 4; ERP70; ERP72) (AP); Protein Disulfide Isomerase Family A; ERP72; anti-PDIA4 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2H3
Specificity
Recognizes PDIA4.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-PDIA4 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PDIA4 (NP_004902, 355aa-464aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LVVMQPEKFQSKYEPRSHMMDVQGSTQDSAIKDFVLKYALPLVGHRKVSNDAKRYTRRPLVVVYYSVDFSFDYRAATQFWRSKVLEVAKDFPEYTFAIADEEDYAGEVKD
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged PDIA4 is approximately 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PDIA4 is approximately 3ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of PDIA4 expression in transfected 293T cell line by PDIA4 monoclonal antibody (M02), clone 2H3.Lane 1: PDIA4 transfected lysate (Predicted MW: 72.9 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PDIA4 expression in transfected 293T cell line by PDIA4 monoclonal antibody (M02), clone 2H3.Lane 1: PDIA4 transfected lysate (Predicted MW: 72.9 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-PDIA4 antibody
Mouse monoclonal antibody raised against a partial recombinant PDIA4.
Product Categories/Family for anti-PDIA4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted: 71 kDa
Observed: 75 kDa
NCBI Official Full Name
protein disulfide-isomerase A4
NCBI Official Synonym Full Names
protein disulfide isomerase family A member 4
NCBI Official Symbol
PDIA4
NCBI Official Synonym Symbols
ERP70; ERP72; ERp-72
NCBI Protein Information
protein disulfide-isomerase A4
UniProt Protein Name
Protein disulfide-isomerase A4
UniProt Gene Name
PDIA4
UniProt Synonym Gene Names
ERP70; ERP72; ER protein 70; ERp70; ER protein 72; ERp-72; ERp72
UniProt Entry Name
PDIA4_HUMAN

Uniprot Description

PDIA4: Part a large chaperone multiprotein complex comprising DNAJB11, HSP90B1, HSPA5, HYOU, PDIA2, PDIA4, PDIA6, PPIB, SDF2L1, UGT1A1 and very small amounts of ERP29, but not, or at very low levels, CALR nor CANX. Belongs to the protein disulfide isomerase family.

Protein type: EC 5.3.4.1; Isomerase; Chaperone; Endoplasmic reticulum

Chromosomal Location of Human Ortholog: 7q35

Cellular Component: cell surface; endoplasmic reticulum; endoplasmic reticulum lumen; melanosome

Molecular Function: protein binding; protein disulfide isomerase activity

Biological Process: protein folding; cell redox homeostasis; protein secretion

Research Articles on PDIA4

Similar Products

Product Notes

The PDIA4 pdia4 (Catalog #AAA6164333) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PDIA4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PDIA4 pdia4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PDIA4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.