Mouse anti-Human PDGFRB Monoclonal Antibody | anti-PDGFRB antibody

PDGFRB (PDGFR, PDGFR1, Platelet-derived Growth Factor Receptor beta, Beta Platelet-derived Growth Factor Receptor, Beta-type Platelet-derived Growth Factor Receptor, CD140 Antigen-like Family Member B, Platelet-derived Growth Factor Receptor 1, CD140b) (M

Cat. Num. AAA6223743

• Gene Names: PDGFRB; IMF1; KOGS; IBGC4; JTK12; PDGFR; PENTT; CD140B; PDGFR1; PDGFR-1
• Reactivity: Human
• Applications: Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PDGFRB; Monoclonal Antibody; PDGFRB (PDGFR; PDGFR1; Platelet-derived Growth Factor Receptor beta; Beta Platelet-derived Growth Factor Receptor; Beta-type Platelet-derived Growth Factor Receptor; CD140 Antigen-like Family Member B; Platelet-derived Growth Factor Receptor 1; CD140b) (M; anti-PDGFRB antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4C12
• Specificity: Recognizes human PDGFRB.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.

• Applicable Applications for anti-PDGFRB antibody: FLISA, Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa33-133 from human PDGFRB (AAH32224) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LVVTPPGPELVLNVSSTFVLTCSGSAPVVWERMSQEPPQEMAKAQDGTFSSVLTLTNLTGLDTGEYFCTHNDSRGLETDERKRLYIFVPDPTVGFLPNDAE
• Conjugate: MaxLight650
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(Western Blot analysis of PDGFRB expression in human stomach using 131071.)

Western Blot (WB)

(Western Blot analysis of PDGFRB expression in human uterus myoma using 131071.)

Immunoprecipitation (IP)

(Immunoprecipitation of PDGFRB transfected lysate using 131071 and Protein A Magnetic Bead, and immunoblotted with PDGFRB rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged PDGFRB is ~1ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis of protein-protein interactions between STAT1 and PDGFRB Mahlavu cells were stained with anti-STAT1 rabbit purified polyclonal (1:1200) and 131071 (1:50). Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Related Product Information for anti-PDGFRB antibody

CD140b is a cell surface tyrosine kinase receptor for members of the platelet-derived growth factor family. The identity of the growth factor bound to the receptor determines whether the functional receptor is a homodimer or heterodimer composed of both PDGFR-a and -B. CD140b contains two immunoglobulin-like domains and a tyrosine kinase domain with a predicted molecular weight ~124kD. CD140b is widely expressed on a variety of mesenchymal-derived cells and is preferentially expressed on some tumors such as medulloblastoma. Binding of B-chain containing PDGF molecules can stimulate cell proliferation. CD140b has been shown to interact with a number of kinases (including Raf-1, NCK1, FAK, Fyn, others) as well as adaptor molecules and signaling intermediates (Crk, Grb2, Grb4, RasGAP, SHP2, SHC1, others), and has also been shown to associate with integrin B3 and nexin sorting molecules. CD140b has been implicated in several disease states including atherogenesis and oncogenesis. The PDGFRB is heavily phosphorylated on numerous tyrosine residues through both autophosphorylation and ligand-dependent processes.

Product Categories/Family for anti-PDGFRB antibody

Antibodies; Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 21594832
• NCBI GeneID: 5159
• Molecular Weight: 37,412 Da
• NCBI Official Full Name: Homo sapiens platelet-derived growth factor receptor, beta polypeptide, mRNA
• NCBI Official Synonym Full Names: platelet derived growth factor receptor beta
• NCBI Official Symbol: PDGFRB
• NCBI Official Synonym Symbols: IMF1; KOGS; IBGC4; JTK12; PDGFR; PENTT; CD140B; PDGFR1; PDGFR-1
• NCBI Protein Information: platelet-derived growth factor receptor beta
• Protein Family: Platelet-derived growth factor receptor

NCBI Description

This gene encodes a cell surface tyrosine kinase receptor for members of the platelet-derived growth factor family. These growth factors are mitogens for cells of mesenchymal origin. The identity of the growth factor bound to a receptor monomer determines whether the functional receptor is a homodimer or a heterodimer, composed of both platelet-derived growth factor receptor alpha and beta polypeptides. This gene is flanked on chromosome 5 by the genes for granulocyte-macrophage colony-stimulating factor and macrophage-colony stimulating factor receptor; all three genes may be implicated in the 5-q syndrome. A translocation between chromosomes 5 and 12, that fuses this gene to that of the translocation, ETV6, leukemia gene, results in chronic myeloproliferative disorder with eosinophilia. [provided by RefSeq, Jul 2008]