Mouse anti-Human PDE1B Monoclonal Antibody | anti-PDE1B antibody

PDE1B (PDE1B1, PDES1B, Calcium/Calmodulin-dependent 3',5'-cyclic Nucleotide Phosphodiesterase 1B, 63kD Cam-PDE) (HRP)

Cat. Num. AAA6154058

• Gene Names: PDE1B; PDE1B1; PDES1B; HEL-S-79p
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PDE1B; Monoclonal Antibody; PDE1B (PDE1B1; PDES1B; Calcium/Calmodulin-dependent 3'; 5'-cyclic Nucleotide Phosphodiesterase 1B; 63kD Cam-PDE) (HRP); anti-PDE1B antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 5B6
• Specificity: Recognizes human PDE1B.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 3236

• Applicable Applications for anti-PDE1B antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa437-536 from human PDE1B (AAH32226) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: TDVAEKSVQPLADEDSKSKNQPSFQWRQPSLDVEVGDPNPDVVSFRSTWVKRIQENKQKWKERAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGNLD
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Testing Data

(Detection limit for recombinant GST tagged PDE1B is ~0.03ng/ml as a capture antibody.)

Related Product Information for anti-PDE1B antibody

Cyclic nucleotide phosphodiesterases (PDEs) catalyze hydrolysis of the cyclic nucleotides cAMP and cGMP to the corresponding nucleoside 5-prime-monophosphates. Mammalian PDEs have been classified into several families based on their biochemical properties. Members of the PDE1 family, such as PDE1B, are calmodulin (see MIM 114180)-dependent PDEs (CaM-PDEs) that are stimulated by a calcium-calmodulin complex (Repaske et al., 1992 [PubMed 1326532]).

Product Categories/Family for anti-PDE1B antibody

Antibodies; Enzymes; Phosphodiesterase

NCBI and Uniprot Product Information

• NCBI GI #: 21594889
• NCBI GeneID: 5153
• NCBI Official Full Name: Homo sapiens phosphodiesterase 1B, calmodulin-dependent, mRNA
• NCBI Official Synonym Full Names: phosphodiesterase 1B
• NCBI Official Symbol: PDE1B
• NCBI Official Synonym Symbols: PDE1B1; PDES1B; HEL-S-79p
• NCBI Protein Information: calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B

NCBI Description

The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE1 subfamily. Members of the PDE1 family are calmodulin-dependent PDEs that are stimulated by a calcium-calmodulin complex. This PDE has dual-specificity for the second messengers, cAMP and cGMP, with a preference for cGMP as a substrate. cAMP and cGMP function as key regulators of many important physiological processes. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.[provided by RefSeq, Jul 2011]