Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (IL17D rabbit polyclonal antibody. Western Blot analysis of IL17D expression in A-431.)

Rabbit anti-Human IL17D Polyclonal Antibody | anti-IL17D antibody

IL17D (Interleukin-17D, IL-17D, Interleukin-27, IL-27, IL27, UNQ3096/PRO21175, FLJ30846) (Biotin)

Gene Names
IL17D; IL27; IL-27; IL-17D
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IL17D; Polyclonal Antibody; IL17D (Interleukin-17D; IL-17D; Interleukin-27; IL-27; IL27; UNQ3096/PRO21175; FLJ30846) (Biotin); anti-IL17D antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human IL17D.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-IL17D antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human IL17D, aa1-356 (NP_612141.1).
Immunogen Sequence
MLVAGFLLALPPSWAAGAPRAGRRPARPRGCADRPEELLEQLYGRLAAGVLSAFHHTLQLGPREQARNASCPAGGRPADRRFRPPTNLRSVSPWAYRISYDPARYPRYLPEAYCLCRGCLTGLFGEEDVRFRSAPVYMPTVVLRRTPACAGGRSVYTEAYVTIPVGCTCVPEPEKDADSINSSIDKQGAKLLLGPNDAPAGP
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(IL17D rabbit polyclonal antibody. Western Blot analysis of IL17D expression in A-431.)

Western Blot (WB) (IL17D rabbit polyclonal antibody. Western Blot analysis of IL17D expression in A-431.)

Western Blot (WB)

(Western Blot analysis of IL17D expression in transfected 293T cell line by IL17D polyclonal antibody. Lane 1: IL17D transfected lysate (21.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of IL17D expression in transfected 293T cell line by IL17D polyclonal antibody. Lane 1: IL17D transfected lysate (21.9kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-IL17D antibody
Induces expression of IL-6, IL-8, and GM-CSF from endothelial cells.
Product Categories/Family for anti-IL17D antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21,893 Da
NCBI Official Full Name
interleukin-17D
NCBI Official Synonym Full Names
interleukin 17D
NCBI Official Symbol
IL17D
NCBI Official Synonym Symbols
IL27; IL-27; IL-17D
NCBI Protein Information
interleukin-17D; interleukin 27
UniProt Protein Name
Interleukin-17D
Protein Family
UniProt Gene Name
IL17D
UniProt Synonym Gene Names
IL27; IL-17D; IL-27
UniProt Entry Name
IL17D_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine that shares the sequence similarity with IL17. The treatment of endothelial cells with this cytokine has been shown to stimulate the production of other cytokines including IL6, IL8 and CSF2/ GM-CSF. The increased expression of IL8 induced by this cytokine was found to be NF-kappa B-dependent. [provided by RefSeq, Jul 2008]

Uniprot Description

IL17D: Induces expression of IL-6, IL-8, and GM-CSF from endothelial cells. Belongs to the IL-17 family.

Protein type: Secreted, signal peptide; Cytokine; Secreted

Chromosomal Location of Human Ortholog: 13q11

Cellular Component: extracellular space

Molecular Function: cytokine activity

Biological Process: inflammatory response

Research Articles on IL17D

Similar Products

Product Notes

The IL17D il17d (Catalog #AAA6382631) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IL17D (Interleukin-17D, IL-17D, Interleukin-27, IL-27, IL27, UNQ3096/PRO21175, FLJ30846) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IL17D can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IL17D il17d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IL17D, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.