<
Western Blot (WB)
(Western Blot detection against Immunogen (36.96kD).)
Mouse PCSK1 Monoclonal Antibody | anti-PCSK1 antibody
PCSK1 (Neuroendocrine Convertase 1, NEC 1, Prohormone Convertase 1, Proprotein Convertase 1, PC1, NEC1) (FITC)
Gene Names
PCSK1; PC1; PC3; NEC1; SPC3; BMIQ12
Reactivity
Human, Mouse, Rat
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PCSK1; Monoclonal Antibody; PCSK1 (Neuroendocrine Convertase 1; NEC 1; Prohormone Convertase 1; Proprotein Convertase 1; PC1; NEC1) (FITC); anti-PCSK1 antibody
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
3D2
Specificity
Recognizes human PCSK1. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-PCSK1 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 30ug/ml
Applications are based on unconjugated antibody.
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa652-754 from human PCSK1 (NP_000430) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GGRRDELEEGAPSEAMLRLLQSAFSKNSPPKQSPKKSPTAKLNIPYENFYEALEKLNKPSQLKDSEDSLYNDYVDVFYNTKPYKHRDDRLLQALVDILNEEN
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (36.96kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (36.96kD).)
Western Blot (WB)
(PCSK1 monoclonal antibody. Western Blot analysis of PCSK1 expression in HeLa.)
Western Blot (WB)
(PCSK1 monoclonal antibody. Western Blot analysis of PCSK1 expression in HeLa.)
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to PCSK1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to PCSK1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to PCSK1 on HeLa cell. [antibody concentration 30ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to PCSK1 on HeLa cell. [antibody concentration 30ug/ml])
Testing Data
(Detection limit for recombinant GST tagged PCSK1 is ~0.03ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged PCSK1 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-PCSK1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
79,010 Da
NCBI Official Full Name
neuroendocrine convertase 1 isoform 1 preproprotein
NCBI Official Synonym Full Names
proprotein convertase subtilisin/kexin type 1
NCBI Official Symbol
PCSK1
NCBI Official Synonym Symbols
PC1; PC3; NEC1; SPC3; BMIQ12
NCBI Protein Information
neuroendocrine convertase 1; prohormone convertase 1; prohormone convertase 3
UniProt Protein Name
Neuroendocrine convertase 1
Protein Family
UniProt Gene Name
PCSK1
UniProt Synonym Gene Names
NEC1; NEC 1; PC1
UniProt Entry Name
NEC1_HUMAN
Uniprot Description
PCSK1: Involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues. Substrates include POMC, renin, enkephalin, dynorphin, somatostatin and insulin. Belongs to the peptidase S8 family. Furin subfamily.
Protein type: EC 3.4.21.93; Protease
Chromosomal Location of Human Ortholog: 5q15-q21
Cellular Component: Golgi apparatus; extracellular space; transport vesicle
Molecular Function: serine-type endopeptidase activity
Biological Process: cellular protein metabolic process; cell-cell signaling; metabolic process; peptide hormone processing; proteolysis; regulation of insulin secretion; peptide biosynthetic process
Disease: Proprotein Convertase 1/3 Deficiency; Body Mass Index Quantitative Trait Locus 12
Similar Products
Product Notes
The PCSK1 pcsk1 (Catalog #AAA6148741) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PCSK1 (Neuroendocrine Convertase 1, NEC 1, Prohormone Convertase 1, Proprotein Convertase 1, PC1, NEC1) (FITC) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PCSK1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 30ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PCSK1 pcsk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PCSK1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
