Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (KIAA0101 monoclonal antibody Western Blot analysis of KIAA0101 expression in JAR)

Mouse anti-Human PCNA-associated Factor Monoclonal Antibody | anti-KIAA0101 antibody

PCNA-associated Factor (Hepatitis C Virus NS5A-transactivated Protein 9, HCV NS5A-transactivated Protein 9, Overexpressed in Anaplastic Thyroid Carcinoma 1, OEATC-1, PCNA-associated Factor of 15kD, PAF15, p15PAF, NS5ATP9, PAF, L5) APC

Gene Names
KIAA0101; L5; PAF; OEATC; PAF15; OEATC1; p15PAF; NS5ATP9; OEATC-1; p15/PAF; p15(PAF)
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PCNA-associated Factor; Monoclonal Antibody; PCNA-associated Factor (Hepatitis C Virus NS5A-transactivated Protein 9; HCV NS5A-transactivated Protein 9; Overexpressed in Anaplastic Thyroid Carcinoma 1; OEATC-1; PCNA-associated Factor of 15kD; PAF15; p15PAF; NS5ATP9; PAF; L5) APC; anti-KIAA0101 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3C11-1F11
Specificity
Recognizes human KIAA0101.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-KIAA0101 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-111 from KIAA0101 (AAH05832) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPD
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(KIAA0101 monoclonal antibody Western Blot analysis of KIAA0101 expression in JAR)

Western Blot (WB) (KIAA0101 monoclonal antibody Western Blot analysis of KIAA0101 expression in JAR)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to KIAA0101 on formalin-fixed paraffin-embedded human lymph node tissue. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to KIAA0101 on formalin-fixed paraffin-embedded human lymph node tissue. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to KIAA0101 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to KIAA0101 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged KIAA0101 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged KIAA0101 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-KIAA0101 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
11,986 Da
NCBI Official Full Name
Homo sapiens KIAA0101, mRNA
NCBI Official Synonym Full Names
KIAA0101
NCBI Official Symbol
KIAA0101
NCBI Official Synonym Symbols
L5; PAF; OEATC; PAF15; OEATC1; p15PAF; NS5ATP9; OEATC-1; p15/PAF; p15(PAF)
NCBI Protein Information
PCNA-associated factor; PCNA-associated factor of 15 kDa; HCV NS5A-transactivated protein 9; hepatitis C virus NS5A-transactivated protein 9; overexpressed in anaplastic thyroid carcinoma 1
UniProt Protein Name
PCNA-associated factor
Protein Family
UniProt Gene Name
KIAA0101
UniProt Synonym Gene Names
NS5ATP9; PAF; HCV NS5A-transactivated protein 9; OEATC-1; PAF15; p15PAF
UniProt Entry Name
PAF15_HUMAN

Uniprot Description

PAF: May be involved in protection of cells from UV-induced cell death.

Protein type: DNA repair, damage

Chromosomal Location of Human Ortholog: 15q22.31

Cellular Component: perinuclear region of cytoplasm; cytoplasm; nucleus

Molecular Function: protein binding; chromatin binding

Biological Process: bypass DNA synthesis; centrosome organization and biogenesis; regulation of cell cycle; DNA replication; response to DNA damage stimulus; response to UV

Similar Products

Product Notes

The KIAA0101 kiaa0101 (Catalog #AAA6138132) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PCNA-associated Factor (Hepatitis C Virus NS5A-transactivated Protein 9, HCV NS5A-transactivated Protein 9, Overexpressed in Anaplastic Thyroid Carcinoma 1, OEATC-1, PCNA-associated Factor of 15kD, PAF15, p15PAF, NS5ATP9, PAF, L5) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PCNA-associated Factor can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KIAA0101 kiaa0101 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PCNA-associated Factor, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.