Western Blot (WB)
(Western Blot detection against Immunogen (38.1kD).)
Mouse anti-Human PCLKC Monoclonal Antibody | anti-CDHR2 antibody
PCLKC (Cadherin-related Family Member 2, Protocadherin LKC, PC-LKC, Protocadherin-24, PCDH24, PCLKC, FLJ20124, FLJ20383, MGC163154)
Gene Names
CDHR2; PCLKC; PCDH24
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
PCLKC; Monoclonal Antibody; PCLKC (Cadherin-related Family Member 2; Protocadherin LKC; PC-LKC; Protocadherin-24; PCDH24; FLJ20124; FLJ20383; MGC163154); Anti -PCLKC (Cadherin-related Family Member 2; anti-CDHR2 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
1D2
Specificity
Recognizes human PCLKC.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
GGMYHNTFTIQCSLPVFLSISVVDQPDLDPQFVREFYSASVAEDAAKGTSVLTVEAVDGDKGINDPVIYSISYSTRPGWFDIGADGVIRVNGSLDREQLLEADEEVQLQ
Applicable Applications for anti-CDHR2 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa210-319 from human PCLKC (NP_060145) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap/
Western Blot (WB)
(Western Blot detection against Immunogen (38.1kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (38.1kD).)
Related Product Information for anti-CDHR2 antibody
Role in contact inhibition at the lateral surface of epithelial cells.
Product Categories/Family for anti-CDHR2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
141,543 Da
NCBI Official Full Name
protocadherin LKC, isoform CRA_d
NCBI Official Synonym Full Names
cadherin-related family member 2
NCBI Official Symbol
CDHR2
NCBI Official Synonym Symbols
PCLKC; PCDH24
NCBI Protein Information
cadherin-related family member 2; protocadherin 24; protocadherin-24
UniProt Protein Name
Cadherin-related family member 2
Protein Family
UniProt Gene Name
CDHR2
UniProt Synonym Gene Names
PCDH24; PCLKC; PC-LKC
UniProt Entry Name
CDHR2_HUMAN
NCBI Description
This gene is a member of the protocadherin family, which represents a subset of the larger cadherin superfamily. The members of the protocadherin family encode non-classical cadherins that function as calcium-dependent cell-cell adhesion molecules. This protocadherin represents a new candidate for tumor suppression. Alternatively spliced transcript variants that encode the same protein have been identified. [provided by RefSeq, Jan 2010]
Uniprot Description
PCDH24: Role in contact inhibition at the lateral surface of epithelial cells.
Protein type: Membrane protein, integral
Chromosomal Location of Human Ortholog: 5q35.2
Cellular Component: apical plasma membrane; integral to membrane; cell junction; brush border
Molecular Function: protein binding; calcium ion binding
Biological Process: negative regulation of cell growth; cell adhesion; homophilic cell adhesion
Research Articles on CDHR2
Similar Products
Product Notes
The CDHR2 cdhr2 (Catalog #AAA6011953) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PCLKC (Cadherin-related Family Member 2, Protocadherin LKC, PC-LKC, Protocadherin-24, PCDH24, PCLKC, FLJ20124, FLJ20383, MGC163154) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PCLKC can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the CDHR2 cdhr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GGMYHNTFTI QCSLPVFLSI SVVDQPDLDP QFVREFYSAS VAEDAAKGTS VLTVEAVDGD KGINDPVIYS ISYSTRPGWF DIGADGVIRV NGSLDREQLL EADEEVQLQ. It is sometimes possible for the material contained within the vial of "PCLKC, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
