Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human PCDHGA1 Monoclonal Antibody | anti-PCDHGA1 antibody

PCDHGA1 (Protocadherin gamma-A1, PCDH-gamma-A1, MGC138287, MGC138289, PCDH-GAMMA-A1)

Gene Names
PCDHGA1; PCDH-GAMMA-A1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
PCDHGA1; Monoclonal Antibody; PCDHGA1 (Protocadherin gamma-A1; PCDH-gamma-A1; MGC138287; MGC138289; PCDH-GAMMA-A1); Anti -PCDHGA1 (Protocadherin gamma-A1; anti-PCDHGA1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4C9
Specificity
Recognizes human PCDHGA1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
AFTQAQYHINVPENVPLGTQLLMVNATDPDEGANGEVTYSFHNVDHRVAQIFRLDSYTGEISNKEPLDFEEYKMYSMEVQAQDGAGLMAKVKVLIKVLDV
Applicable Applications for anti-PCDHGA1 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa241-342 from human PCDHGA1 (NP_061735) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Testing Data

(Detection limit for recombinant GST tagged PCDHGA1 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PCDHGA1 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-PCDHGA1 antibody
Potential calcium-dependent cell-adhesion protein. May be involved in the establishment and maintenance of specific neuronal connections in the brain.
Product Categories/Family for anti-PCDHGA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
101,226 Da
NCBI Official Full Name
protocadherin gamma-A1 isoform 2
NCBI Official Synonym Full Names
protocadherin gamma subfamily A, 1
NCBI Official Symbol
PCDHGA1
NCBI Official Synonym Symbols
PCDH-GAMMA-A1
NCBI Protein Information
protocadherin gamma-A1
UniProt Protein Name
Protocadherin gamma-A1
Protein Family
UniProt Gene Name
PCDHGA1
UniProt Synonym Gene Names
PCDH-gamma-A1
UniProt Entry Name
PCDG1_HUMAN

NCBI Description

This gene is a member of the protocadherin gamma gene cluster, one of three related clusters tandemly linked on chromosome five. These gene clusters have an immunoglobulin-like organization, suggesting that a novel mechanism may be involved in their regulation and expression. The gamma gene cluster includes 22 genes divided into 3 subfamilies. Subfamily A contains 12 genes, subfamily B contains 7 genes and 2 pseudogenes, and the more distantly related subfamily C contains 3 genes. The tandem array of 22 large, variable region exons are followed by a constant region, containing 3 exons shared by all genes in the cluster. Each variable region exon encodes the extracellular region, which includes 6 cadherin ectodomains and a transmembrane region. The constant region exons encode the common cytoplasmic region. These neural cadherin-like cell adhesion proteins most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been described for the gamma cluster genes. [provided by RefSeq, Jul 2008]

Uniprot Description

PCDHGA1: Potential calcium-dependent cell-adhesion protein. May be involved in the establishment and maintenance of specific neuronal connections in the brain. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell adhesion; Membrane protein, integral; Calcium-binding

Chromosomal Location of Human Ortholog: 5q31

Cellular Component: integral to membrane; plasma membrane

Molecular Function: calcium ion binding

Biological Process: homophilic cell adhesion

Research Articles on PCDHGA1

Similar Products

Product Notes

The PCDHGA1 pcdhga1 (Catalog #AAA6000825) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PCDHGA1 (Protocadherin gamma-A1, PCDH-gamma-A1, MGC138287, MGC138289, PCDH-GAMMA-A1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PCDHGA1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the PCDHGA1 pcdhga1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AFTQAQYHIN VPENVPLGTQ LLMVNATDPD EGANGEVTYS FHNVDHRVAQ IFRLDSYTGE ISNKEPLDFE EYKMYSMEVQ AQDGAGLMAK VKVLIKVLDV. It is sometimes possible for the material contained within the vial of "PCDHGA1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.