Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.12kD).)

Mouse anti-Human PCF11 Monoclonal Antibody | anti-PCF11 antibody

PCF11 (Pre-mRNA Cleavage Complex 2 Protein Pcf11, Pre-mRNA Cleavage Complex II Protein Pcf11, KIAA0824) (AP)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PCF11; Monoclonal Antibody; PCF11 (Pre-mRNA Cleavage Complex 2 Protein Pcf11; Pre-mRNA Cleavage Complex II Protein Pcf11; KIAA0824) (AP); anti-PCF11 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3G4
Specificity
Recognizes human PCF11.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-PCF11 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1465-1555 from human PCF11 (NP_056969) partial recombinant with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NAIRVDGKIYHPSCYEDYQNTSSFDCTPSPSKTPVENPLNIMLNIVKNELQEPCDSPKVKEERIDTPPACTEESIATPSEIKTENDTVESV
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.12kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.12kD).)

Testing Data

(Detection limit for recombinant GST tagged PCF11 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PCF11 is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-PCF11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
173,050 Da
NCBI Official Full Name
pre-mRNA cleavage complex 2 protein Pcf11 isoform 3
NCBI Official Synonym Full Names
PCF11 cleavage and polyadenylation factor subunit
NCBI Official Symbol
PCF11
NCBI Protein Information
pre-mRNA cleavage complex 2 protein Pcf11
UniProt Protein Name
Pre-mRNA cleavage complex 2 protein Pcf11
Protein Family
UniProt Gene Name
PCF11
UniProt Synonym Gene Names
KIAA0824

NCBI Description

The protein encoded by this gene binds to CLP1 to form pre-mRNA cleavage factor IIm. The encoded protein is necessary for efficient Pol II transcription termination and may be involved in degradation of the 3' product of polyA site cleavage. [provided by RefSeq, Oct 2016]

Uniprot Description

PCF11: Component of pre-mRNA cleavage complex II.

Protein type: RNA processing; RNA splicing

Chromosomal Location of Human Ortholog: 11q14.1

Cellular Component: cytoplasm; mitochondrion; mRNA cleavage factor complex; nucleoplasm

Molecular Function: mRNA binding

Biological Process: mRNA 3'-end processing; mRNA cleavage; mRNA polyadenylation; mRNA splicing, via spliceosome; termination of RNA polymerase II transcription

Research Articles on PCF11

Similar Products

Product Notes

The PCF11 pcf11 (Catalog #AAA6132820) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PCF11 (Pre-mRNA Cleavage Complex 2 Protein Pcf11, Pre-mRNA Cleavage Complex II Protein Pcf11, KIAA0824) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PCF11 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PCF11 pcf11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PCF11, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.