Western Blot (WB)
(Western Blot detection against Immunogen (36.89kD).)
Mouse anti-Human PCDHB3 Monoclonal Antibody | anti-PCDHB3 antibody
PCDHB3 (Protocadherin beta-3, PCDH-beta-3, PCDH-BETA3) (Biotin)
Gene Names
PCDHB3; PCDH-BETA3
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PCDHB3; Monoclonal Antibody; PCDHB3 (Protocadherin beta-3; PCDH-beta-3; PCDH-BETA3) (Biotin); anti-PCDHB3 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4F6
Specificity
Recognizes human PCDHB3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-PCDHB3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa284-382 from human PCDHB3 (NP_061760) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ASEEIRKTFQLNPITGDMQLVKYLNFEAINSYEVDIEAKDGGGLSGKSTVIVQVVDVNDNPPELTLSSVNSPIPENSGETVLAVFSVSDLDSGDNGRV
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (36.89kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (36.89kD).)
Testing Data
(Detection limit for recombinant GST tagged PCDHB3 is ~0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged PCDHB3 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-PCDHB3 antibody
This gene is a member of the protocadherin beta gene cluster, one of three related gene clusters tandemly linked on chromosome five. The gene clusters demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The beta cluster contains 16 genes and 3 pseudogenes, each encoding 6 extracellular cadherin domains and a cytoplasmic tail that deviates from others in the cadherin superfamily. The extracellular domains interact in a homophilic manner to specify differential cell-cell connections. Unlike the alpha and gamma clusters, the transcripts from these genes are made up of only one large exon, not sharing common 3' exons as expected. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins. Their specific functions are unknown but they most likely play a critical role in the establishment and function of specific cell-cell neural connections.
Product Categories/Family for anti-PCDHB3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
86,773 Da
NCBI Official Full Name
protocadherin beta-3
NCBI Official Synonym Full Names
protocadherin beta 3
NCBI Official Symbol
PCDHB3
NCBI Official Synonym Symbols
PCDH-BETA3
NCBI Protein Information
protocadherin beta-3
UniProt Protein Name
Protocadherin beta-3
Protein Family
UniProt Gene Name
PCDHB3
UniProt Synonym Gene Names
PCDH-beta-3
UniProt Entry Name
PCDB3_HUMAN
Similar Products
Product Notes
The PCDHB3 pcdhb3 (Catalog #AAA6143415) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PCDHB3 (Protocadherin beta-3, PCDH-beta-3, PCDH-BETA3) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PCDHB3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PCDHB3 pcdhb3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PCDHB3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
