Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.47kD).)

Mouse anti-Human PCDHA6 Monoclonal Antibody | anti-PCDHA6 antibody

PCDHA6 (Protocadherin alpha-6, PCDH-alpha-6, CNRS2) (HRP)

Gene Names
PCDHA6; CNR2; CNRN2; CNRS2; CRNR2; PCDH-ALPHA6
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PCDHA6; Monoclonal Antibody; PCDHA6 (Protocadherin alpha-6; PCDH-alpha-6; CNRS2) (HRP); anti-PCDHA6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1A3
Specificity
Recognizes human PCDHA6.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-PCDHA6 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa295-371 from human PCDHA6 (NP_061732) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IDRNTGEIVIRGNLDFEQENLYKILIDATDKGHPPMAGHCTVLVRILDKNDNVPEIALTSLSLPVREDAQFGTVIA
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.47kD).)

Western Blot (WB) (Western Blot detection against Immunogen (34.47kD).)

Western Blot (WB)

(PCDHA6 monoclonal antibody, Western Blot analysis of PCDHA6 expression in K-562.)

Western Blot (WB) (PCDHA6 monoclonal antibody, Western Blot analysis of PCDHA6 expression in K-562.)

Testing Data

(Detection limit for recombinant GST tagged PCDHA6 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PCDHA6 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-PCDHA6 antibody
Potential calcium-dependent cell-adhesion protein. May be involved in the establishment and maintenance of specific neuronal connections in the brain.
Product Categories/Family for anti-PCDHA6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
86,845 Da
NCBI Official Full Name
protocadherin alpha-6 isoform 1
NCBI Official Synonym Full Names
protocadherin alpha 6
NCBI Official Symbol
PCDHA6
NCBI Official Synonym Symbols
CNR2; CNRN2; CNRS2; CRNR2; PCDH-ALPHA6
NCBI Protein Information
protocadherin alpha-6; KIAA0345-like 8; PCDH-alpha-6
UniProt Protein Name
Protocadherin alpha-6
Protein Family
UniProt Gene Name
PCDHA6
UniProt Synonym Gene Names
CNRS2; PCDH-alpha-6
UniProt Entry Name
PCDA6_HUMAN

Similar Products

Product Notes

The PCDHA6 pcdha6 (Catalog #AAA6154012) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PCDHA6 (Protocadherin alpha-6, PCDH-alpha-6, CNRS2) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PCDHA6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PCDHA6 pcdha6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PCDHA6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.