Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-PIK3CD Polyclonal Antibody)

Rabbit anti-Mouse PIK3CD Polyclonal Antibody | anti-PIK3CD antibody

PIK3CD Polyclonal Antibody

Gene Names
PIK3CD; APDS; PI3K; IMD14; p110D; P110DELTA
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
PIK3CD; Polyclonal Antibody; PIK3CD Polyclonal Antibody; APDS; IMD14; P110DELTA; PI3K; p110D; phosphatidylinositol-4; 5-bisphosphate 3-kinase catalytic subunit delta; anti-PIK3CD antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.68 mg/ml (varies by lot)
Sequence Length
1044
Applicable Applications for anti-PIK3CD antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 150-250 of human PIK3CD (NP_005017.3).
Immunogen Sequence
AAARRQQLGWEAWLQYSFPLQLEPSAQTWGPGTLRLPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYTLQVNGRHEYL
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-PIK3CD Polyclonal Antibody)

Western Blot (WB) (Western blot-PIK3CD Polyclonal Antibody)
Related Product Information for anti-PIK3CD antibody
Phosphoinositide 3-kinases (PI3Ks) phosphorylate inositol lipids and are involved in the immune response. The protein encoded by this gene is a class I PI3K found primarily in leukocytes. Like other class I PI3Ks (p110-alpha p110-beta, and p110-gamma), the encoded protein binds p85 adapter proteins and GTP-bound RAS. However, unlike the other class I PI3Ks, this protein phosphorylates itself, not p85 protein.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated: 33kDa; 119kDa
Observed: 119kDa
NCBI Official Full Name
Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
NCBI Official Synonym Full Names
phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta
NCBI Official Symbol
PIK3CD
NCBI Official Synonym Symbols
APDS; PI3K; IMD14; p110D; P110DELTA
NCBI Protein Information
phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
UniProt Protein Name
Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
UniProt Gene Name
PIK3CD
UniProt Synonym Gene Names
PI3-kinase subunit delta; PI3K-delta; PI3Kdelta; PtdIns-3-kinase subunit delta; PtdIns-3-kinase subunit p110-delta; p110delta
UniProt Entry Name
PK3CD_HUMAN

NCBI Description

Phosphoinositide 3-kinases (PI3Ks) phosphorylate inositol lipids and are involved in the immune response. The protein encoded by this gene is a class I PI3K found primarily in leukocytes. Like other class I PI3Ks (p110-alpha p110-beta, and p110-gamma), the encoded protein binds p85 adapter proteins and GTP-bound RAS. However, unlike the other class I PI3Ks, this protein phosphorylates itself, not p85 protein.[provided by RefSeq, Jul 2010]

Uniprot Description

PIK3CD: Phosphoinositide-3-kinase (PI3K) that phosphorylates PftdIns(4,5)P2 (Phosphatidylinositol 4,5-bisphosphate) to generate phosphatidylinositol 3,4,5-trisphosphate (PIP3). PIP3 plays a key role by recruiting PH domain-containing proteins to the membrane, including AKT1 and PDPK1, activating signaling cascades involved in cell growth, survival, proliferation, motility and morphology. Mediates immune responses. Plays a role in B-cell development, proliferation, migration, and function. Required for B-cell receptor (BCR) signaling. Mediates B-cell proliferation response to anti-IgM, anti-CD40 and IL4 stimulation. Promotes cytokine production in response to TLR4 and TLR9. Required for antibody class switch mediated by TLR9. Involved in the antigen presentation function of B-cells. Involved in B-cell chemotaxis in response to CXCL13 and sphingosine 1-phosphate (S1P). Required for proliferation, signaling and cytokine production of naive, effector and memory T-cells. Required for T-cell receptor (TCR) signaling. Mediates TCR signaling events at the immune synapse. Activation by TCR leads to antigen-dependent memory T-cell migration and retention to antigenic tissues. Together with PIK3CG participates in T-cell development. Contributes to T-helper cell expansion and differentiation. Required for T-cell migration mediated by homing receptors SELL/CD62L, CCR7 and S1PR1 and antigen dependent recruitment of T-cells. Together with PIK3CG is involved in natural killer (NK) cell development and migration towards the sites of inflammation. Participates in NK cell receptor activation. Have a role in NK cell maturation and cytokine production. Together with PIK3CG is involved in neutrophil chemotaxis and extravasation. Together with PIK3CG participates in neutrophil respiratory burst. Have important roles in mast-cell development and mast cell mediated allergic response. Involved in stem cell factor (SCF)-mediated proliferation, adhesion and migration. Required for allergen-IgE-induced degranulation and cytokine release. The lipid kinase activity is required for its biological function. Isoform 2 may be involved in stabilizing total RAS levels, resulting in increased ERK phosphorylation and increased PI3K activity. Belongs to the PI3/PI4-kinase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Carbohydrate Metabolism - inositol phosphate; Kinase, lipid; EC 2.7.1.153; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 1p36.2

Cellular Component: mast cell granule; plasma membrane; cytosol; phosphoinositide 3-kinase complex

Molecular Function: protein binding; phosphatidylinositol-4,5-bisphosphate 3-kinase activity; 1-phosphatidylinositol-3-kinase activity; ATP binding; phosphoinositide 3-kinase activity; phosphatidylinositol-4-phosphate 3-kinase activity

Biological Process: respiratory burst during defense response; phosphoinositide 3-kinase cascade; T cell activation; nerve growth factor receptor signaling pathway; natural killer cell activation; signal transduction; T cell receptor signaling pathway; protein amino acid phosphorylation; B cell receptor signaling pathway; B cell homeostasis; phosphoinositide phosphorylation; natural killer cell differentiation; phospholipid metabolic process; inflammatory response; T cell differentiation; epidermal growth factor receptor signaling pathway; neutrophil chemotaxis; adaptive immune response; phosphoinositide-mediated signaling; fibroblast growth factor receptor signaling pathway; B cell activation; mast cell chemotaxis; cytokine production; mast cell degranulation; phosphatidylinositol biosynthetic process; innate immune response

Disease: Immunodeficiency 14

Research Articles on PIK3CD

Similar Products

Product Notes

The PIK3CD pik3cd (Catalog #AAA9140795) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PIK3CD Polyclonal Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's PIK3CD can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the PIK3CD pik3cd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PIK3CD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.