Mouse anti-Human PCDH19 Monoclonal Antibody | anti-PCDH19 antibody

PCDH19 (Protocadherin-19, DKFZp686P1843, KIAA1313) (FITC)

Cat. Num. AAA6148701

• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PCDH19; Monoclonal Antibody; PCDH19 (Protocadherin-19; DKFZp686P1843; KIAA1313) (FITC); anti-PCDH19 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2G10
• Specificity: Recognizes human PCDH19.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 1100

• Applicable Applications for anti-PCDH19 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa241-341 from human PCDH19 (NP_065817) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RLVPRDVEETDKMNVVSCSSLTSSLNYFDYHQQTLPLGCRRSESTFLNVENQNTRNTSANHIYHHSFNSQGPQQPDLIINGAPLPETENYSFDSNYVNSR
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Product Categories/Family for anti-PCDH19 antibody

Antibodies; Cadherin

NCBI and Uniprot Product Information

• NCBI GI #: 157426845
• NCBI Accession #: NP_065817
• NCBI GenBank Nucleotide #: NM_020766
• UniProt Accession #: Q8TAB3
• NCBI Official Full Name: protocadherin-19 isoform b
• UniProt Protein Name: Protocadherin-19
• Protein Family: Protocadherin
• UniProt Gene Name: PCDH19
• UniProt Synonym Gene Names: KIAA1313
• UniProt Entry Name: PCD19_HUMAN

Uniprot Description

Function: Potential calcium-dependent cell-adhesion protein.

Subcellular location: Cell membrane; Single-pass type I membrane protein

By similarity.

Tissue specificity: Moderately expressed in all regions of the brain examined, with lowest levels found in the cerebellum. Moderate expression is also found in ovary, and low expression in all other tissues tested. Also detected in primary skin fibroblast. Ref.1 Ref.5

Developmental stage: Expressed in developing cortical plate, amygdala and subcortical regions and in the ganglionic eminence. Ref.1

Involvement in disease: Epileptic encephalopathy, early infantile, 9 (EIEE9) [MIM:300088]: A condition characterized by seizure with onset in infancy or early childhood, cognitive impairment, and delayed development of variable severity in some patients. Additional features include autistic signs and psychosis. The disorder is sex-limited, with the phenotype being restricted to females.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.1 Ref.6 Ref.7 Ref.8 Ref.9 Ref.10 Ref.11 Ref.12 Ref.13 Ref.14

Sequence similarities: Contains 6 cadherin domains.

Sequence caution: The sequence CAH18133.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.The sequence CAI41393.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.The sequence CAI41394.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.