Mouse anti-Human PCDHB1 Monoclonal Antibody | anti-PCDHB1 antibody

PCDHB1 (Protocadherin beta-1, MGC138301, MGC138303, PCDH-beta-1)

Cat. Num. AAA6003310

• Gene Names: PCDHB1; PCDH-BETA1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Ascites; Ascites
• Synonyms: PCDHB1; Monoclonal Antibody; PCDHB1 (Protocadherin beta-1; MGC138301; MGC138303; PCDH-beta-1); Anti -PCDHB1 (Protocadherin beta-1; anti-PCDHB1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgM,k
• Clone Number: 1H4
• Specificity: Recognizes human PCDHB1.
• Purity/Purification: Ascites; Ascites
• Form/Format: Supplied as a liquid in ascites fluid.
• Sequence: QFSRLVYRAQVSENSPNGSLVATVTAVDLDEGTNKAITYSLAQNPEAILKTFQIDPQNGEVRLRGPLDFEAIETYDIDIQATDGGGLSAHSKVLVEVVDV*

• Applicable Applications for anti-PCDHB1 antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Partial recombinant corresponding to aa241-341 from human PCDHB1 (NP_037472) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Related Product Information for anti-PCDHB1 antibody

This gene is a member of the protocadherin beta gene cluster, one of three related gene clusters tandemly linked on chromosome five. The gene clusters demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The beta cluster contains 16 genes and 3 pseudogenes, each encoding 6 extracellular cadherin domains and a cytoplasmic tail that deviates from others in the cadherin superfamily. The extracellular domains interact in a homophilic manner to specify differential cell-cell connections. Unlike the alpha and gamma clusters, the transcripts from these genes are made up of only one large exon, not sharing common 3' exons as expected. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins. Their specific functions are unknown but they most likely play a critical role in the establishment and function of specific cell-cell neural connections.

Product Categories/Family for anti-PCDHB1 antibody

Antibodies; Abs to Cadherin

NCBI and Uniprot Product Information

• NCBI GI #: 14195607
• NCBI GeneID: 29930
• NCBI Accession #: NP_037472.2
• NCBI GenBank Nucleotide #: NM_013340.3
• UniProt Accession #: Q9Y5F3; Q2M257
• Molecular Weight: 90,491 Da
• NCBI Official Full Name: protocadherin beta-1
• NCBI Official Synonym Full Names: protocadherin beta 1
• NCBI Official Symbol: PCDHB1
• NCBI Official Synonym Symbols: PCDH-BETA1
• NCBI Protein Information: protocadherin beta-1; PCDH-beta-1
• UniProt Protein Name: Protocadherin beta-1
• Protein Family: Protocadherin
• UniProt Gene Name: PCDHB1
• UniProt Synonym Gene Names: PCDH-beta-1
• UniProt Entry Name: PCDB1_HUMAN

NCBI Description

This gene is a member of the protocadherin beta gene cluster, one of three related gene clusters tandemly linked on chromosome five. The gene clusters demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The beta cluster contains 16 genes and 3 pseudogenes, each encoding 6 extracellular cadherin domains and a cytoplasmic tail that deviates from others in the cadherin superfamily. The extracellular domains interact in a homophilic manner to specify differential cell-cell connections. Unlike the alpha and gamma clusters, the transcripts from these genes are made up of only one large exon, not sharing common 3' exons as expected. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins. Their specific functions are unknown but they most likely play a critical role in the establishment and function of specific cell-cell neural connections. [provided by RefSeq, Jul 2008]

Uniprot Description

PCDHB1: Potential calcium-dependent cell-adhesion protein. May be involved in the establishment and maintenance of specific neuronal connections in the brain.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 5q31

Cellular Component: integral to membrane; plasma membrane

Molecular Function: calcium ion binding

Biological Process: homophilic cell adhesion