Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of PCDH10 expression in transfected 293T cell line by PCDH10 monoclonal antibody (M01), clone 4H8.Lane 1: PCDH10 transfected lysate(112.9 KDa).Lane 2: Non-transfected lysate.)

Mouse PCDH10 Monoclonal Antibody | anti-PCDH10 antibody

PCDH10 (Protocadherin 10, DKFZp761O2023, KIAA1400, MGC133344, OL-PCDH, PCDH19) (APC)

Gene Names
PCDH10; PCDH19; OL-PCDH
Applications
Western Blot
Purity
Purified
Synonyms
PCDH10; Monoclonal Antibody; PCDH10 (Protocadherin 10; DKFZp761O2023; KIAA1400; MGC133344; OL-PCDH; PCDH19) (APC); Protocadherin 10; PCDH19; anti-PCDH10 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4H8
Specificity
Recognizes PCDH10.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-PCDH10 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PCDH10 (NP_065866, 18aa-127aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SQLHYTVQEEQEHGTFVGNIAEDLGLDITKLSARGFQTVPNSRTPYLDLNLETGVLYVNEKIDREQICKQSPSCVLHLEVFLENPLELFQVEIEVLDINDNPPSFPEPDL
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PCDH10 expression in transfected 293T cell line by PCDH10 monoclonal antibody (M01), clone 4H8.Lane 1: PCDH10 transfected lysate(112.9 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PCDH10 expression in transfected 293T cell line by PCDH10 monoclonal antibody (M01), clone 4H8.Lane 1: PCDH10 transfected lysate(112.9 KDa).Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged PCDH10 is 0.3 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PCDH10 is 0.3 ng/ml as a capture antibody.)
Related Product Information for anti-PCDH10 antibody
This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. The mRNA encodes a cadherin-related neuronal receptor thought to play a role in the establishment and function of specific cell-cell connections in the brain. This family member contains 6 extracellular cadherin domains, a transmembrane domain and a cytoplasmic tail differing from those of the classical cadherins. Alternatively spliced transcripts encode isoforms with unique cytoplasmic domains. [provided by RefSeq]
Product Categories/Family for anti-PCDH10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
97,002 Da
NCBI Official Full Name
protocadherin-10 isoform 2
NCBI Official Synonym Full Names
protocadherin 10
NCBI Official Symbol
PCDH10
NCBI Official Synonym Symbols
PCDH19; OL-PCDH
NCBI Protein Information
protocadherin-10
UniProt Protein Name
Protocadherin-10
Protein Family
UniProt Gene Name
PCDH10
UniProt Synonym Gene Names
KIAA1400
UniProt Entry Name
PCD10_HUMAN

Similar Products

Product Notes

The PCDH10 pcdh10 (Catalog #AAA6167355) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PCDH10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PCDH10 pcdh10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PCDH10, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.