Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PBX1 monoclonal antibody (M02), clone 3F7 Western Blot analysis of PBX1 expression in Hela S3 NE (Cat # L013V3).)

Mouse PBX1 Monoclonal Antibody | anti-PBX1 antibody

PBX1 (pre-B-Cell Leukemia Homeobox 1, DKFZp686B09108, MGC126627) (FITC)

Gene Names
PBX1; CAKUHED
Applications
Western Blot
Purity
Purified
Synonyms
PBX1; Monoclonal Antibody; PBX1 (pre-B-Cell Leukemia Homeobox 1; DKFZp686B09108; MGC126627) (FITC); pre-B-Cell Leukemia Homeobox 1; MGC126627; anti-PBX1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3F7
Specificity
Recognizes PBX1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-PBX1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PBX1 (NP_002576, 213aa-321aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAAKTAVTATNVSAHGS
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PBX1 monoclonal antibody (M02), clone 3F7 Western Blot analysis of PBX1 expression in Hela S3 NE (Cat # L013V3).)

Western Blot (WB) (PBX1 monoclonal antibody (M02), clone 3F7 Western Blot analysis of PBX1 expression in Hela S3 NE (Cat # L013V3).)

Testing Data

(Detection limit for recombinant GST tagged PBX1 is approximately 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PBX1 is approximately 0.3ng/ml as a capture antibody.)
Related Product Information for anti-PBX1 antibody
Mouse monoclonal antibody raised against a partial recombinant PBX1.
Product Categories/Family for anti-PBX1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
pre-B-cell leukemia transcription factor 1 isoform 1
NCBI Official Synonym Full Names
PBX homeobox 1
NCBI Official Symbol
PBX1
NCBI Official Synonym Symbols
CAKUHED
NCBI Protein Information
pre-B-cell leukemia transcription factor 1
UniProt Protein Name
Pre-B-cell leukemia transcription factor 1
UniProt Gene Name
PBX1
UniProt Synonym Gene Names
PRL
UniProt Entry Name
PBX1_HUMAN

NCBI Description

This gene encodes a nuclear protein that belongs to the PBX homeobox family of transcriptional factors. Studies in mice suggest that this gene may be involved in the regulation of osteogenesis and required for skeletal patterning and programming. A chromosomal translocation, t(1;19) involving this gene and TCF3/E2A gene, is associated with pre-B-cell acute lymphoblastic leukemia. The resulting fusion protein, in which the DNA binding domain of E2A is replaced by the DNA binding domain of this protein, transforms cells by constitutively activating transcription of genes regulated by the PBX protein family. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2017]

Uniprot Description

PBX1: Binds the sequence 5'-ATCAATCAA-3'. Acts as a transcriptional activator of PF4 in complex with MEIS1. Converted into a potent transcriptional activator by the (1;19) translocation. May have a role in steroidogenesis and, subsequently, sexual development and differentiation. Forms a heterodimer with MEIS1 which binds DNA including a cAMP-responsive sequence in CYP17. Also forms heterotrimers with MEIS1 and a number of HOX proteins including HOXA9, HOXD4, HOXD9 and HOXD10. Interacts with PBXIP1. Expressed in all tissues except in cells of the B and T lineage. Belongs to the TALE/PBX homeobox family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; DNA-binding; Oncoprotein; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 1q23

Cellular Component: nucleoplasm; transcription factor complex; cytoplasm; nucleus

Molecular Function: protein binding; DNA binding; protein heterodimerization activity; transcription factor binding; transcription factor activity

Biological Process: spleen development; transcription, DNA-dependent; thymus development; embryonic hemopoiesis; somatic stem cell maintenance; adrenal gland development; negative regulation of transcription factor activity; embryonic skeletal development; anterior/posterior pattern formation; negative regulation of neuron differentiation; ureteric bud branching; positive regulation of cell proliferation; positive regulation of transcription from RNA polymerase II promoter; regulation of ossification; steroid biosynthetic process; sex differentiation; proximal/distal pattern formation; embryonic limb morphogenesis

Research Articles on PBX1

Similar Products

Product Notes

The PBX1 pbx1 (Catalog #AAA6176950) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PBX1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PBX1 pbx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PBX1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.