Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PBK monoclonal antibody. Western Blot analysis of PBK expression in human skeletal muscle.)

Mouse anti-Human PBK Monoclonal Antibody | anti-PBK antibody

PBK (Lymphokine-activated Killer T-cell-originated Protein Kinase, Cancer/Testis Antigen 84, CT84, MAPKK-like Protein Kinase, Nori-3, PDZ-binding Kinase, Spermatogenesis-related Protein Kinase, SPK, T-LAK Cell-originated Protein Kinase, TOPK, FLJ14385) (H

Gene Names
PBK; SPK; CT84; TOPK; HEL164; Nori-3
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PBK; Monoclonal Antibody; PBK (Lymphokine-activated Killer T-cell-originated Protein Kinase; Cancer/Testis Antigen 84; CT84; MAPKK-like Protein Kinase; Nori-3; PDZ-binding Kinase; Spermatogenesis-related Protein Kinase; SPK; T-LAK Cell-originated Protein Kinase; TOPK; FLJ14385) (H; anti-PBK antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3A11
Specificity
Recognizes human PBK.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-PBK antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-110 from human PBK (AAH15191) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGS
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PBK monoclonal antibody. Western Blot analysis of PBK expression in human skeletal muscle.)

Western Blot (WB) (PBK monoclonal antibody. Western Blot analysis of PBK expression in human skeletal muscle.)

Western Blot (WB)

(PBK monoclonal antibody, Western Blot analysis of PBK expression in A-431.)

Western Blot (WB) (PBK monoclonal antibody, Western Blot analysis of PBK expression in A-431.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PBK on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to PBK on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PBK on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to PBK on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged PBK is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PBK is ~1ng/ml as a capture antibody.)
Product Categories/Family for anti-PBK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
37,211 Da
NCBI Official Full Name
Homo sapiens PDZ binding kinase, mRNA
NCBI Official Synonym Full Names
PDZ binding kinase
NCBI Official Symbol
PBK
NCBI Official Synonym Symbols
SPK; CT84; TOPK; HEL164; Nori-3
NCBI Protein Information
lymphokine-activated killer T-cell-originated protein kinase

NCBI Description

This gene encodes a serine/threonine protein kinase related to the dual specific mitogen-activated protein kinase kinase (MAPKK) family. Evidence suggests that mitotic phosphorylation is required for its catalytic activity. The encoded protein may be involved in the activation of lymphoid cells and support testicular functions, with a suggested role in the process of spermatogenesis. Overexpression of this gene has been implicated in tumorigenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]

Research Articles on PBK

Similar Products

Product Notes

The PBK (Catalog #AAA6153993) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PBK (Lymphokine-activated Killer T-cell-originated Protein Kinase, Cancer/Testis Antigen 84, CT84, MAPKK-like Protein Kinase, Nori-3, PDZ-binding Kinase, Spermatogenesis-related Protein Kinase, SPK, T-LAK Cell-originated Protein Kinase, TOPK, FLJ14385) (H reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PBK can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PBK for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PBK, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.