Mouse PBK Monoclonal Antibody | anti-PBK antibody

PBK (PDZ Binding Kinase, FLJ14385, Nori-3, SPK, TOPK) (APC)

Cat. Num. AAA6166700

• Gene Names: PBK; SPK; CT84; TOPK; HEL164; Nori-3
• Applications: Western Blot
• Purity: Purified
• Synonyms: PBK; Monoclonal Antibody; PBK (PDZ Binding Kinase; FLJ14385; Nori-3; SPK; TOPK) (APC); PDZ Binding Kinase; TOPK; anti-PBK antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2D6
• Specificity: Recognizes PBK.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 322

• Applicable Applications for anti-PBK antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: PBK (AAH15191, 1aa-322aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDV
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(PBK monoclonal antibody (M03), clone 2D6 Western Blot analysis of PBK expression in NIH/3T3.)

Testing Data

(Detection limit for recombinant GST tagged PBK is approximately 0.03ng/ml as a capture antibody.)

Western Blot (WB)

(PBK monoclonal antibody (M03), clone 2D6. Western Blot analysis of PBK expression in PC-12.)

Western Blot (WB)

(PBK monoclonal antibody (M03), clone 2D6. Western Blot analysis of PBK expression in Raw 264.7.)

Related Product Information for anti-PBK antibody

This genes encodes a serine/threonine kinase related to the dual specific mitogen-activated protein kinase kinase (MAPKK) family. Evidence suggests that mitotic phosphorylation is required for its catalytic activity. This mitotic kinase may be involved in the activation of lymphoid cells and support testicular functions, with a suggested role in the process of spermatogenesis. [provided by RefSeq]

Product Categories/Family for anti-PBK antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 15929525
• NCBI GeneID: 55872
• NCBI Official Full Name: PDZ binding kinase
• NCBI Official Synonym Full Names: PDZ binding kinase
• NCBI Official Symbol: PBK
• NCBI Official Synonym Symbols: SPK; CT84; TOPK; HEL164; Nori-3
• NCBI Protein Information: lymphokine-activated killer T-cell-originated protein kinase
• Protein Family: Lymphokine-activated killer T-cell-originated protein kinase

NCBI Description

This gene encodes a serine/threonine protein kinase related to the dual specific mitogen-activated protein kinase kinase (MAPKK) family. Evidence suggests that mitotic phosphorylation is required for its catalytic activity. The encoded protein may be involved in the activation of lymphoid cells and support testicular functions, with a suggested role in the process of spermatogenesis. Overexpression of this gene has been implicated in tumorigenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]