Mouse PAX8 Monoclonal Antibody | anti-PAX8 antibody

PAX8 (Paired Box 8) (Biotin)

Cat. Num. AAA6170954

• Applications: Western Blot
• Purity: Purified
• Synonyms: PAX8; Monoclonal Antibody; PAX8 (Paired Box 8) (Biotin); Paired Box 8; anti-PAX8 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3G11
• Specificity: Recognizes PAX8.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-PAX8 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: PAX8 (NP_003457, 300aa-377aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DPHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPH
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PAX8 monoclonal antibody (M10), clone 3G11. Western Blot analysis of PAX8 expression in human parotid gland.)

Testing Data

(Detection limit for recombinant GST tagged PAX8 is approximately 1ng/ml as a capture antibody.)

Western Blot (WB)

(PAX8 monoclonal antibody (M10), clone 3G11. Western Blot analysis of PAX8 expression in human ovarian cancer.)

Related Product Information for anti-PAX8 antibody

This gene encodes a member of the paired box (PAX) family of transcription factors. Members of this gene family typically encode proteins that contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in thyroid follicular cell development and expression of thyroid-specific genes. Mutations in this gene have been associated with thyroid dysgenesis, thyroid follicular carcinomas and atypical follicular thyroid adenomas. Alternateively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq]

Product Categories/Family for anti-PAX8 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 5803117
• NCBI GeneID: 7849
• NCBI Accession #: NP_003457
• NCBI GenBank Nucleotide #: NM_003466
• UniProt Accession #: Q06710; Q09155; Q16337; Q16338; Q16339; Q4ZG35; Q96J49
• Molecular Weight: 31,044 Da
• NCBI Official Full Name: paired box protein Pax-8 isoform PAX8A
• NCBI Official Synonym Full Names: paired box 8
• NCBI Official Symbol: PAX8
• NCBI Protein Information: paired box protein Pax-8; paired domain gene 8
• UniProt Protein Name: Paired box protein Pax-8
• Protein Family: Paired box protein
• UniProt Gene Name: PAX8
• UniProt Entry Name: PAX8_HUMAN

Uniprot Description

PAX8: Transcription factor for the thyroid-specific expression of the genes exclusively expressed in the thyroid cell type, maintaining the functional differentiation of such cells. Interacts with WWTR1. Expressed in the excretory system, thyroid gland and Wilms tumors. 5 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 2q13

Cellular Component: nucleoplasm; nucleus

Molecular Function: protein binding; DNA binding; transcription factor activity; thyroid-stimulating hormone receptor activity

Biological Process: regulation of apoptosis; anatomical structure morphogenesis; inner ear morphogenesis; central nervous system development; transcription, DNA-dependent; ureteric bud branching; positive regulation of transcription, DNA-dependent; thyroid gland development; positive regulation of transcription from RNA polymerase II promoter; mesonephros development; kidney development; pronephros development; urogenital system development

Disease: Hypothyroidism, Congenital, Nongoitrous, 2