Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (32.16kD).)

Mouse anti-Human PANK2 Monoclonal Antibody | anti-PANK2 antibody

PANK2 (Pantothenate Kinase 2, Mitochondrial, hPanK2, Pantothenic Acid Kinase 2, C20orf48, FLJ11729, FLJ17232, MGC15053) (Biotin)

Gene Names
PANK2; HSS; HARP; PKAN; NBIA1; C20orf48
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PANK2; Monoclonal Antibody; PANK2 (Pantothenate Kinase 2; Mitochondrial; hPanK2; Pantothenic Acid Kinase 2; C20orf48; FLJ11729; FLJ17232; MGC15053) (Biotin); anti-PANK2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B12
Specificity
Recognizes human PANK2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-PANK2 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 1-10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa205-260 from human PANK2 (NP_705902) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IGDLQLCKLDELDCLIKGILYIDSVGFNGRSQCYYFENPADSEKCQKLPFDLKNP
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.16kD).)

Western Blot (WB) (Western Blot detection against Immunogen (32.16kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PANK2 on formalin-fixed paraffin-embedded human endometrium tissue. [antibody concentration 1~10ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to PANK2 on formalin-fixed paraffin-embedded human endometrium tissue. [antibody concentration 1~10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged PANK2 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PANK2 is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-PANK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
50,582 Da
NCBI Official Full Name
pantothenate kinase 2, mitochondrial isoform 1 preproprotein
NCBI Official Synonym Full Names
pantothenate kinase 2
NCBI Official Symbol
PANK2
NCBI Official Synonym Symbols
HSS; HARP; PKAN; NBIA1; C20orf48
NCBI Protein Information
pantothenate kinase 2, mitochondrial
UniProt Protein Name
Pantothenate kinase 2, mitochondrial
Protein Family
UniProt Gene Name
PANK2
UniProt Synonym Gene Names
C20orf48
UniProt Entry Name
PANK2_HUMAN

NCBI Description

This gene encodes a protein belonging to the pantothenate kinase family and is the only member of that family to be expressed in mitochondria. Pantothenate kinase is a key regulatory enzyme in the biosynthesis of coenzyme A (CoA) in bacteria and mammalian cells. It catalyzes the first committed step in the universal biosynthetic pathway leading to CoA and is itself subject to regulation through feedback inhibition by acyl CoA species. Mutations in this gene are associated with HARP syndrome and pantothenate kinase-associated neurodegeneration (PKAN), formerly Hallervorden-Spatz syndrome. Alternative splicing, involving the use of alternate first exons, results in multiple transcripts encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

PANK2: a pantothenate kinase that catalyzes the first committed step in the biosynthesis of coenzyme A, an essential cofactor in cellular metabolism. PANK2 is predominantly localized in mitochondria in primates. Defects in PANK2 are the cause of pantothenate kinase-associated neurodegeneration (PKAN), an autosomal recessive neurodegenerative disorder associated with iron accumulation in the brain. Three isoforms of the human PANK2, produced by alternative splicing, have been reported.

Protein type: Kinase, other; Mitochondrial; EC 2.7.1.33; Cofactor and Vitamin Metabolism - pantothenate and CoA biosynthesis

Chromosomal Location of Human Ortholog: 20p13

Cellular Component: mitochondrial intermembrane space; cytosol

Molecular Function: pantothenate kinase activity; ATP binding

Biological Process: coenzyme A biosynthetic process; coenzyme biosynthetic process; vitamin metabolic process; regulation of mitochondrial membrane potential; pantothenate metabolic process; aerobic respiration; phosphorylation; spermatid development; water-soluble vitamin metabolic process

Disease: Hypoprebetalipoproteinemia, Acanthocytosis, Retinitis Pigmentosa, And Pallidal Degeneration; Neurodegeneration With Brain Iron Accumulation 1

Research Articles on PANK2

Similar Products

Product Notes

The PANK2 pank2 (Catalog #AAA6143359) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PANK2 (Pantothenate Kinase 2, Mitochondrial, hPanK2, Pantothenic Acid Kinase 2, C20orf48, FLJ11729, FLJ17232, MGC15053) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PANK2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 1-10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PANK2 pank2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PANK2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.