Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.12kD).)

Mouse anti-Human, Rat PALM2 Monoclonal Antibody | anti-PALM2 antibody

PALM2 (Paralemmin 2, Paralemmin-2)

Gene Names
PALM2; AKAP2
Reactivity
Human, Rat
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
PALM2; Monoclonal Antibody; PALM2 (Paralemmin 2; Paralemmin-2); Anti -PALM2 (Paralemmin 2; anti-PALM2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1A8
Specificity
Recognizes human PALM2. Species Crossreactivity: rat.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
EDEEETKKVLGYDETIKAELVLIDEDDEKSLREKTVTDVSTIDGNAAELVSGRPVSDTTEPSSPEGKEESLATEPAPGTQKKKRCQCCVVM
Applicable Applications for anti-PALM2 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa321-412 from human PALM2 (NP_443749) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.12kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.12kD).)

Western Blot (WB)

(PALM2 monoclonal antibody. Western Blot analysis of PALM2 expression in PC-12.)

Western Blot (WB) (PALM2 monoclonal antibody. Western Blot analysis of PALM2 expression in PC-12.)

Western Blot (WB)

(PALM2 monoclonal antibody, Western Blot analysis of PALM2 expression in Hela NE.)

Western Blot (WB) (PALM2 monoclonal antibody, Western Blot analysis of PALM2 expression in Hela NE.)

Western Blot (WB)

(Western Blot analysis of PALM2 expression in transfected 293T cell line by PALM2 monoclonal antibody.|Lane 1: PALM2 transfected lysate (42.2kD).|Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PALM2 expression in transfected 293T cell line by PALM2 monoclonal antibody.|Lane 1: PALM2 transfected lysate (42.2kD).|Lane 2: Non-transfected lysate.)

Western Blot (WB)

(Western Blot analysis of PALM2 expression in transfected 293T cell line by PALM2 monoclonal antibody.|Lane 1: PALM2 transfected lysate (42.2kD).|Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PALM2 expression in transfected 293T cell line by PALM2 monoclonal antibody.|Lane 1: PALM2 transfected lysate (42.2kD).|Lane 2: Non-transfected lysate.)
Related Product Information for anti-PALM2 antibody
Paralemmin 2 (PALM2) is expressed in infantile heart and muscle, and fibroblasts. The specific function of paralemmin 2 is unknown. It is adjacent to the AKAP2 gene on chromosome 9q31-q33 and can be differentially expressed as a natural AKAP2-PALM2 chimeric protein.
Product Categories/Family for anti-PALM2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,185 Da
NCBI Official Full Name
paralemmin-2 isoform a
NCBI Official Synonym Full Names
paralemmin 2
NCBI Official Symbol
PALM2
NCBI Official Synonym Symbols
AKAP2
NCBI Protein Information
paralemmin-2; A kinase (PRKA) anchor protein 2
UniProt Protein Name
Paralemmin-2
Protein Family
UniProt Gene Name
PALM2
UniProt Entry Name
PALM2_HUMAN

Uniprot Description

PALM2: Belongs to the paralemmin family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Kinase, other

Chromosomal Location of Human Ortholog: 9q31.3

Cellular Component: plasma membrane

Biological Process: regulation of cell shape

Research Articles on PALM2

Similar Products

Product Notes

The PALM2 palm2 (Catalog #AAA6001255) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PALM2 (Paralemmin 2, Paralemmin-2) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PALM2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the PALM2 palm2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EDEEETKKVL GYDETIKAEL VLIDEDDEKS LREKTVTDVS TIDGNAAELV SGRPVSDTTE PSSPEGKEES LATEPAPGTQ KKKRCQCCVV M. It is sometimes possible for the material contained within the vial of "PALM2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.