Mouse anti-Human, Mouse PAGE4 Monoclonal Antibody | anti-PAGE4 antibody

PAGE4 (G Antigen Family C Member 1, PAGE-1, Prostate-associated Gene 4 Protein, PAGE-4, GAGEC1, JM27)

Cat. Num. AAA647036

• Gene Names: PAGE4; JM27; JM-27; CT16.7; GAGE-9; GAGEC1; PAGE-1; PAGE-4
• Reactivity: Human, Mouse
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: PAGE4; Monoclonal Antibody; PAGE4 (G Antigen Family C Member 1; PAGE-1; Prostate-associated Gene 4 Protein; PAGE-4; GAGEC1; JM27); Anti -PAGE4 (G Antigen Family C Member 1; anti-PAGE4 antibody

• Host: Mouse
• Reactivity: Human, Mouse
• Clonality: Monoclonal
• Isotype: IgG2b, kappa
• Clone Number: 7C3
• Specificity: Recognizes human PAGE4.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MSARVRSRSRGRGDGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQP

• Applicable Applications for anti-PAGE4 antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Full length recombinant corresponding to aa1-102 from PAGE4 (NP_008934) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Related Product Information for anti-PAGE4 antibody

PAGE4 belongs to the GAGE family of genes which are expressed in a variety of tumors and in some fetal and reproductive tissues. PAGE4 is strongly expressed in prostate and prostate cancer, but is also expressed in other male and female reproductive tissues including testis, fallopian tube, uterus, and placenta, as well as in testicular cancer and uterine cancer.

Product Categories/Family for anti-PAGE4 antibody

Antibodies; Abs to Cancer Markers

NCBI and Uniprot Product Information

• NCBI GI #: 5901986
• NCBI GeneID: 9506
• NCBI Accession #: NP_008934.1
• NCBI GenBank Nucleotide #: NM_007003.3
• UniProt Accession #: O60829; Q6IBI1; B2R529; D3DX68
• Molecular Weight: 11,153 Da
• NCBI Official Full Name: P antigen family member 4
• NCBI Official Synonym Full Names: P antigen family, member 4 (prostate associated)
• NCBI Official Symbol: PAGE4
• NCBI Official Synonym Symbols: JM27; JM-27; CT16.7; GAGE-9; GAGEC1; PAGE-1; PAGE-4
• NCBI Protein Information: P antigen family member 4; g antigen family C member 1; prostate-associated gene protein 4
• UniProt Protein Name: P antigen family member 4
• Protein Family: P antigen family
• UniProt Gene Name: PAGE4
• UniProt Synonym Gene Names: GAGEC1; PAGE-4
• UniProt Entry Name: PAGE4_HUMAN

NCBI Description

This gene is a member of the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in prostate and prostate cancer. It is also expressed in other male and female reproductive tissues including testis, fallopian tube, uterus, and placenta, as well as in testicular cancer and uterine cancer. The protein encoded by this gene shares sequence similarity with other GAGE/PAGE proteins, and also belongs to a family of CT (cancer-testis) antigens. The protein may play a role in benign and malignant prostate diseases. A related pseudogene is located on chromosome 7. [provided by RefSeq, Aug 2013]

Uniprot Description

Tissue specificity: Preferentially expressed in normal male and female reproductive tissues, prostate, testis, fallopian tube, uterus, and placenta, as well as in prostate cancer, testicular cancer, and uterine cancer.

Sequence similarities: Belongs to the GAGE family.