Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online
product-image-AAA24891_APP6.jpg Application Data (Detection limit for recombinant GST tagged PAFAH1B3 is ~0.1ng/ml as a capture antibody.)

Mouse anti-Human, Rat PAFAH1B3 Monoclonal Antibody | anti-PAFAH1B3 antibody

PAFAH1B3 (Platelet-activating Factor Acetylhydrolase IB subunit gamma, PAF Acetylhydrolase 29kD Subunit, PAF-AH 29kD Subunit, PAF-AH Subunit gamma, PAFAH Subunit gamma, PAFAHG) (Biotin)

Gene Names
PAFAH1B3; PAFAHG
Reactivity
Human, Rat
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PAFAH1B3, Antibody; PAFAH1B3 (Platelet-activating Factor Acetylhydrolase IB subunit gamma, PAF Acetylhydrolase 29kD Subunit, PAF-AH 29kD Subunit, PAF-AH Subunit gamma, PAFAH Subunit gamma, PAFAHG) (Biotin); anti-PAFAH1B3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
8C11
Specificity
Recognizes human PAFAH1B3. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-PAFAH1B3 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-232 from human PAFAH1B3 (AAH03016) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSGEENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDGTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLLAQDQGQGAPLLEPAP
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged PAFAH1B3 is ~0.1ng/ml as a capture antibody.)

product-image-AAA24891_APP6.jpg Application Data (Detection limit for recombinant GST tagged PAFAH1B3 is ~0.1ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to PAFAH1B3 on HeLa cell. [antibody concentration 10ug/ml])

product-image-AAA24891_IF5.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to PAFAH1B3 on HeLa cell. [antibody concentration 10ug/ml])

WB (Western Blot)

(PAFAH1B3 monoclonal antibody Western Blot analysis of PAFAH1B3 expression in Jurkat.)

product-image-AAA24891_WB4.jpg WB (Western Blot) (PAFAH1B3 monoclonal antibody Western Blot analysis of PAFAH1B3 expression in Jurkat.)

WB (Western Blot)

(PAFAH1B3 monoclonal antibody Western Blot analysis of PAFAH1B3 expression in IMR-32.)

product-image-AAA24891_WB3.jpg WB (Western Blot) (PAFAH1B3 monoclonal antibody Western Blot analysis of PAFAH1B3 expression in IMR-32.)

WB (Western Blot)

(PAFAH1B3 monoclonal antibody Western Blot analysis of PAFAH1B3 expression in PC-12.)

product-image-AAA24891_WB2.jpg WB (Western Blot) (PAFAH1B3 monoclonal antibody Western Blot analysis of PAFAH1B3 expression in PC-12.)

WB (Western Blot)

(Western Blot detection against Immunogen (51.15kD).)

product-image-AAA24891_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (51.15kD).)
Product Categories/Family for anti-PAFAH1B3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
25,734 Da
NCBI Official Full Name
Homo sapiens platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit 29kDa, mRNA
NCBI Official Synonym Full Names
platelet activating factor acetylhydrolase 1b catalytic subunit 3
NCBI Official Symbol
PAFAH1B3
NCBI Official Synonym Symbols
PAFAHG
NCBI Protein Information
platelet-activating factor acetylhydrolase IB subunit gamma

Similar Products

Product Notes

The PAFAH1B3 (Catalog #AAA24891) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PAFAH1B3 (Platelet-activating Factor Acetylhydrolase IB subunit gamma, PAF Acetylhydrolase 29kD Subunit, PAF-AH 29kD Subunit, PAF-AH Subunit gamma, PAFAH Subunit gamma, PAFAHG) (Biotin) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PAFAH1B3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PAFAH1B3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PAFAH1B3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.