Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.1kD).)

Mouse anti-Human PADI4 Monoclonal Antibody | anti-PADI4 antibody

PADI4 (Protein-arginine Deiminase Type IV, Protein-arginine Deiminase Type-4, Peptidylarginine Deiminase IV, HL-60 PAD, PADI5, PDI5) APC

Gene Names
PADI4; PAD; PAD4; PDI4; PDI5; PADI5
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PADI4; Monoclonal Antibody; PADI4 (Protein-arginine Deiminase Type IV; Protein-arginine Deiminase Type-4; Peptidylarginine Deiminase IV; HL-60 PAD; PADI5; PDI5) APC; anti-PADI4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4D8
Specificity
Recognizes human PADI4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
2267
Applicable Applications for anti-PADI4 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa2-111 from PADI4 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AQGTLIRVTPEQPTHAVCVLGTLTQLDICSSAPEDCTSFSINASPGVVVDIAHSPPAKKKSTGSSTWPLDPGVEVTLTMKAASGSTGDQKVQISYYGPKTPPVKALLYL*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.1kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.1kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PADI4 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to PADI4 on HeLa cell. [antibody concentration 10ug/ml])
Product Categories/Family for anti-PADI4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens peptidyl arginine deiminase 4 (PADI4), mRNA
NCBI Official Synonym Full Names
peptidyl arginine deiminase 4
NCBI Official Symbol
PADI4
NCBI Official Synonym Symbols
PAD; PAD4; PDI4; PDI5; PADI5
NCBI Protein Information
protein-arginine deiminase type-4
UniProt Protein Name
Protein-arginine deiminase type-4
UniProt Gene Name
PADI4
UniProt Synonym Gene Names
PADI5; PDI5
UniProt Entry Name
PADI4_HUMAN

NCBI Description

This gene is a member of a gene family which encodes enzymes responsible for the conversion of arginine residues to citrulline residues. This gene may play a role in granulocyte and macrophage development leading to inflammation and immune response. [provided by RefSeq, Jul 2008]

Uniprot Description

PADI4: Catalyzes the citrullination/deimination of arginine residues of proteins. Citrullinates histone H3 at 'Arg-8' and/or 'Arg-17' and histone H4 at 'Arg-3', which prevents their methylation by CARM1 and HRMT1L2/PRMT1 and represses transcription. Citrullinates EP300/P300 at 'Arg-2142', which favors its interaction with NCOA2/GRIP1. Genetic variations in PADI4 are a cause of susceptibility to rheumatoid arthritis (RA). It is a systemic inflammatory disease with autoimmune features and a complex genetic component. It primarily affects the joints and is characterized by inflammatory changes in the synovial membranes and articular structures, widespread fibrinoid degeneration of the collagen fibers in mesenchymal tissues, and by atrophy and rarefaction of bony structures. Could have an important role in the pathogenesis of rheumatoid arthritis by increasing citrullination of proteins in rheumatoid arthritis synovial tissues, leading, in a cytokine-rich milieu, to a break in tolerance to citrullinated peptides processed and presented in the appropriate HLA context. Belongs to the protein arginine deiminase family.

Protein type: Nuclear receptor co-regulator; Hydrolase; EC 3.5.3.15

Chromosomal Location of Human Ortholog: 1p36.13

Cellular Component: cytoplasm; nucleus

Molecular Function: arginine deiminase activity; protein binding; calcium ion binding; protein-arginine deiminase activity

Biological Process: chromatin remodeling; nucleosome assembly; transcription, DNA-dependent; regulation of transcription, DNA-dependent; stem cell maintenance; innate immune response; protein modification process; chromatin modification; peptidyl-citrulline biosynthetic process from peptidyl-arginine

Disease: Rheumatoid Arthritis

Research Articles on PADI4

Similar Products

Product Notes

The PADI4 padi4 (Catalog #AAA6138039) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PADI4 (Protein-arginine Deiminase Type IV, Protein-arginine Deiminase Type-4, Peptidylarginine Deiminase IV, HL-60 PAD, PADI5, PDI5) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PADI4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PADI4 padi4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PADI4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.