Mouse OTOA Monoclonal Antibody | anti-OTOA antibody

OTOA (Otoancorin, DFNB22, FLJ32773, MGC157747, MGC39813) (PE)

Cat. Num. AAA6187972

• Gene Names: OTOA; CT108; DFNB22
• Applications: ELISA, Western Blot
• Purity: Purified
• Synonyms: OTOA; Monoclonal Antibody; OTOA (Otoancorin; DFNB22; FLJ32773; MGC157747; MGC39813) (PE); Otoancorin; MGC39813; anti-OTOA antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1F5
• Specificity: Recognizes OTOA.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-OTOA antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: OTOA (NP_653273.3, 27aa-124aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: NSRQDLHPLLQNMAEEIIDGSYLNALLDLIQFQSSHVWTDDLSHRVLAYLNSRNVAFTIPSLQAAVENHLEQRLHQPQKLLEDLRKTDAQQFRTAMKC
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged OTOA is 0.03 ng/ml as a capture antibody.)

Related Product Information for anti-OTOA antibody

The protein encoded by this gene is specifically expressed in the inner ear, and is located at the interface between the apical surface of the inner ear sensory epithelia and their overlying acellular gels. It is prposed that this protein is involved in the attachment of the inner ear acellular gels to the apical surface of the underlying nonsensory cells. Mutations in this gene are associated with autosomal recessive deafness type 22 (DFNB22). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Product Categories/Family for anti-OTOA antibody

Antibodies; Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 77404409
• NCBI GeneID: 146183
• NCBI Accession #: NP_653273.3
• NCBI GenBank Nucleotide #: NM_144672.3
• UniProt Accession #: Q7RTW8; Q8NA86; Q96M76; A1L3A8; A2VDI0; B3KWU3; E9PF51
• Molecular Weight: 128,533 Da
• NCBI Official Full Name: otoancorin isoform 1
• NCBI Official Synonym Full Names: otoancorin
• NCBI Official Symbol: OTOA
• NCBI Official Synonym Symbols: CT108; DFNB22
• NCBI Protein Information: otoancorin; cancer/testis antigen 108
• UniProt Protein Name: Otoancorin
• Protein Family: Otoancorin
• UniProt Gene Name: OTOA
• UniProt Entry Name: OTOAN_HUMAN

NCBI Description

The protein encoded by this gene is specifically expressed in the inner ear, and is located at the interface between the apical surface of the inner ear sensory epithelia and their overlying acellular gels. It is prposed that this protein is involved in the attachment of the inner ear acellular gels to the apical surface of the underlying nonsensory cells. Mutations in this gene are associated with autosomal recessive deafness type 22 (DFNB22). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009]

Uniprot Description

OTOA: May act as an adhesion molecule. Defects in OTOA are the cause of deafness autosomal recessive type 22 (DFNB22). DFNB22 is a form of sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information. Belongs to the stereocilin family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Extracellular matrix; Cancer Testis Antigen (CTA); Membrane protein, GPI anchor

Chromosomal Location of Human Ortholog: 16p12.2|16p12.2

Cellular Component: proteinaceous extracellular matrix; apical plasma membrane

Biological Process: sensory perception of sound; cell-matrix adhesion; transmission of nerve impulse

Disease: Deafness, Autosomal Recessive 22