Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (OSBP monoclonal antibody (M01), clone 5A3. Western Blot analysis of OSBP expression in Jurkat.)

Mouse OSBP Monoclonal Antibody | anti-OSBP antibody

OSBP (Oxysterol Binding Protein, OSBP1) (AP)

Gene Names
OSBP; OSBP1
Applications
Western Blot
Purity
Purified
Synonyms
OSBP; Monoclonal Antibody; OSBP (Oxysterol Binding Protein; OSBP1) (AP); Oxysterol Binding Protein; OSBP1; anti-OSBP antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5A3
Specificity
Recognizes OSBP.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-OSBP antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
OSBP (NP_002547.1, 324aa-407aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GATVLPANTPGNVGSGKDQCCSGKGDMSDEDDENEFFDAPEIITMPENLGHKRTGSNISGASSDISLDEQYKHQLEETKKEKRT
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(OSBP monoclonal antibody (M01), clone 5A3. Western Blot analysis of OSBP expression in Jurkat.)

Western Blot (WB) (OSBP monoclonal antibody (M01), clone 5A3. Western Blot analysis of OSBP expression in Jurkat.)

Testing Data

(Detection limit for recombinant GST tagged OSBP is 0.03 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged OSBP is 0.03 ng/ml as a capture antibody.)
Related Product Information for anti-OSBP antibody
Oxysterol binding protein is an intracellular protein that is believed to transport sterols from lysosomes to the nucleus where the sterol down-regulates the genes for the LDL receptor, HMG-CoA reductase, and HMG synthetase [provided by RefSeq]
Product Categories/Family for anti-OSBP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
89,421 Da
NCBI Official Full Name
oxysterol-binding protein 1
NCBI Official Synonym Full Names
oxysterol binding protein
NCBI Official Symbol
OSBP
NCBI Official Synonym Symbols
OSBP1
NCBI Protein Information
oxysterol-binding protein 1
Protein Family

NCBI Description

Oxysterol binding protein is an intracellular protein that is believed to transport sterols from lysosomes to the nucleus where the sterol down-regulates the genes for the LDL receptor, HMG-CoA reductase, and HMG synthetase [provided by RefSeq, Jul 2008]

Research Articles on OSBP

Similar Products

Product Notes

The OSBP (Catalog #AAA6165722) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's OSBP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the OSBP for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "OSBP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.