Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to ORC4L on HeLa cell. [antibody concentration 10ug/ml])
Mouse anti-Human ORC4L Monoclonal Antibody | anti-ORC4L antibody
ORC4L (Origin Recognition Complex Subunit 4, ORC4) (FITC)
Gene Names
ORC4; ORC4L; ORC4P
Reactivity
Human
Applications
ELISA, Immunofluorescence
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ORC4L; Monoclonal Antibody; ORC4L (Origin Recognition Complex Subunit 4; ORC4) (FITC); anti-ORC4L antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2A8
Specificity
Recognizes human ORC4L.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
1681
Applicable Applications for anti-ORC4L antibody
ELISA (EIA), Immunofluorescence (IF)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-249 from human ORC4L (AAH05388) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSSRKSKSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKRTALHGESNSVLIIGPRGSGKTMLISHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLNLENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDISQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAEFPDKVFAEK
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to ORC4L on HeLa cell. [antibody concentration 10ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to ORC4L on HeLa cell. [antibody concentration 10ug/ml])
Testing Data
(Detection limit for recombinant GST tagged ORC4L is ~1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged ORC4L is ~1ng/ml as a capture antibody.)
Product Categories/Family for anti-ORC4L antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens origin recognition complex, subunit 4-like (yeast), mRNA
NCBI Official Synonym Full Names
origin recognition complex subunit 4
NCBI Official Symbol
ORC4
NCBI Official Synonym Symbols
ORC4L; ORC4P
NCBI Protein Information
origin recognition complex subunit 4
NCBI Description
The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. This gene encodes a subunit of the ORC complex. Several alternatively spliced transcript variants, some of which encode the same protein, have been reported for this gene. [provided by RefSeq, Oct 2010]
Research Articles on ORC4L
Similar Products
Product Notes
The ORC4L (Catalog #AAA6148624) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ORC4L (Origin Recognition Complex Subunit 4, ORC4) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ORC4L can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ORC4L for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ORC4L, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
